Property Summary

NCBI Gene PubMed Count 14
PubMed Score 1.32
PubTator Score 2.75

Knowledge Summary

Patent

No data available

Gene RIF (8)

AA Sequence

MESCSVAQAGVLTSPFMWRWTGMAGALSALDNTIEDDADDQLPCGEGRPGWVRGELLGSQGVCKDSKDLF      1 - 70
VPTSSSLYGCFCVGLVSGMAISVLLLASDFRKLDFSRPEPCFEKEASLWFVAQH                     71 - 124
//

Text Mined References (16)

PMID Year Title