Property Summary

NCBI Gene PubMed Count 42
PubMed Score 21.61
PubTator Score 41.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (17)

Disease log2 FC p
Alzheimer's disease -1.100 4.2e-02
astrocytic glioma -1.400 1.0e-02
Astrocytoma, Pilocytic 2.300 5.5e-07
Breast cancer 1.500 2.4e-02
Chronic Lymphocytic Leukemia 2.878 8.8e-07
fibroadenoma 1.400 3.8e-02
glioblastoma 1.100 5.0e-02
group 3 medulloblastoma -1.700 2.0e-03
lung adenocarcinoma 1.200 5.1e-04
lung cancer 2.800 6.4e-05
malignant mesothelioma 4.300 3.7e-08
medulloblastoma, large-cell -1.700 3.7e-03
oligodendroglioma -1.100 4.5e-02
Pick disease -1.400 3.5e-04
pituitary cancer -1.400 3.4e-03
progressive supranuclear palsy -1.400 7.2e-03
tuberculosis -1.200 8.7e-05

Gene RIF (23)

AA Sequence

MAGPRACAPLLLLLLLGELLAAAGAQRVGLPGPPGPPGPPGKPGQDGIDGEAGPPGLPGPPGPKGAPGKP      1 - 70
GKPGEAGLPGLPGVDGLTGRDGPPGPKGAPGERGSLGPPGPPGLGGKGLPGPPGEAGVSGPPGGIGLRGP     71 - 140
PGPSGLPGLPGPPGPPGPPGHPGVLPEGATDLQCPSICPPGPPGPPGMPGFKGPTGYKGEQGEVGKDGEK    141 - 210
GDPGPPGPAGLPGSVGLQGPRGLRGLPGPLGPPGDRGPIGFRGPPGIPGAPGKAGDRGERGPEGFRGPKG    211 - 280
DLGRPGPKGTPGVAGPSGEPGMPGKDGQNGVPGLDGQKGEAGRNGAPGEKGPNGLPGLPGRAGSKGEKGE    281 - 350
RGRAGELGEAGPSGEPGVPGDAGMPGERGEAGHRGSAGALGPQGPPGAPGVRGFQGQKGSMGDPGLPGPQ    351 - 420
GLRGDVGDRGPGGAAGPKGDQGIAGSDGLPGDKGELGPSGLVGPKGESGSRGELGPKGTQGPNGTSGVQG    421 - 490
VPGPPGPLGLQGVPGVPGITGKPGVPGKEASEQRIRELCGGMISEQIAQLAAHLRKPLAPGSIGRPGPAG    491 - 560
PPGPPGPPGSIGHPGARGPPGYRGPTGELGDPGPRGNQGDRGDKGAAGAGLDGPEGDQGPQGPQGVPGTS    561 - 630
KDGQDGAPGEPGPPGDPGLPGAIGAQGTPGICDTSACQGAVLGGVGEKSGSRSS                    631 - 684
//

Text Mined References (40)

PMID Year Title