Property Summary

NCBI Gene PubMed Count 86
PubMed Score 80.77
PubTator Score 76.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Alport syndrome, recessive type 2 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 1.2
Kidney cancer 2548 0.0 0.6
Disease Target Count Z-score Confidence
Keratoconus 111 3.559 1.8
Disease Target Count Z-score Confidence
Alport syndrome 20 7.714 3.9

Expression

  Differential Expression (16)

Disease log2 FC p
acute quadriplegic myopathy 1.004 1.1e-03
adrenocortical carcinoma -1.516 3.0e-07
Astrocytoma, Pilocytic 1.700 1.5e-04
Atopic dermatitis 1.600 4.9e-04
colon cancer -1.400 3.4e-03
cystic fibrosis 1.032 8.8e-04
ductal carcinoma in situ 1.100 2.8e-02
ileal Crohn's disease -1.294 4.3e-02
interstitial cystitis 1.300 4.3e-02
intraductal papillary-mucinous neoplasm ... -1.500 2.9e-02
lung adenocarcinoma -1.500 1.7e-07
lung cancer -2.800 8.1e-05
non-small cell lung cancer -1.362 1.9e-11
pituitary cancer -2.500 8.5e-10
primary Sjogren syndrome 2.100 2.3e-04
psoriasis 1.200 1.5e-18

Protein-protein Interaction (2)

Gene RIF (53)

AA Sequence

MWSLHIVLMRCSFRLTKSLATGPWSLILILFSVQYVYGSGKKYIGPCGGRDCSVCHCVPEKGSRGPPGPP      1 - 70
GPQGPIGPLGAPGPIGLSGEKGMRGDRGPPGAAGDKGDKGPTGVPGFPGLDGIPGHPGPPGPRGKPGMSG     71 - 140
HNGSRGDPGFPGGRGALGPGGPLGHPGEKGEKGNSVFILGAVKGIQGDRGDPGLPGLPGSWGAGGPAGPT    141 - 210
GYPGEPGLVGPPGQPGRPGLKGNPGVGVKGQMGDPGEVGQQGSPGPTLLVEPPDFCLYKGEKGIKGIPGM    211 - 280
VGLPGPPGRKGESGIGAKGEKGIPGFPGPRGDPGSYGSPGFPGLKGELGLVGDPGLFGLIGPKGDPGNRG    281 - 350
HPGPPGVLVTPPLPLKGPPGDPGFPGRYGETGDVGPPGPPGLLGRPGEACAGMIGPPGPQGFPGLPGLPG    351 - 420
EAGIPGRPDSAPGKPGKPGSPGLPGAPGLQGLPGSSVIYCSVGNPGPQGIKGKVGPPGGRGPKGEKGNEG    421 - 490
LCACEPGPMGPPGPPGLPGRQGSKGDLGLPGWLGTKGDPGPPGAEGPPGLPGKHGASGPPGNKGAKGDMV    491 - 560
VSRVKGHKGERGPDGPPGFPGQPGSHGRDGHAGEKGDPGPPGDHEDATPGGKGFPGPLGPPGKAGPVGPP    561 - 630
GLGFPGPPGERGHPGVPGHPGVRGPDGLKGQKGDTISCNVTYPGRHGPPGFDGPPGPKGFPGPQGAPGLS    631 - 700
GSDGHKGRPGTPGTAEIPGPPGFRGDMGDPGFGGEKGSSPVGPPGPPGSPGVNGQKGIPGDPAFGHLGPP    701 - 770
GKRGLSGVPGIKGPRGDPGCPGAEGPAGIPGFLGLKGPKGREGHAGFPGVPGPPGHSCERGAPGIPGQPG    771 - 840
LPGYPGSPGAPGGKGQPGDVGPPGPAGMKGLPGLPGRPGAHGPPGLPGIPGPFGDDGLPGPPGPKGPRGL    841 - 910
PGFPGFPGERGKPGAEGCPGAKGEPGEKGMSGLPGDRGLRGAKGAIGPPGDEGEMAIISQKGTPGEPGPP    911 - 980
GDDGFPGERGDKGTPGMQGRRGEPGRYGPPGFHRGEPGEKGQPGPPGPPGPPGSTGLRGFIGFPGLPGDQ    981 - 1050
GEPGSPGPPGFSGIDGARGPKGNKGDPASHFGPPGPKGEPGSPGCPGHFGASGEQGLPGIQGPRGSPGRP   1051 - 1120
GPPGSSGPPGCPGDHGMPGLRGQPGEMGDPGPRGLQGDPGIPGPPGIKGPSGSPGLNGLHGLKGQKGTKG   1121 - 1190
ASGLHDVGPPGPVGIPGLKGERGDPGSPGISPPGPRGKKGPPGPPGSSGPPGPAGATGRAPKDIPDPGPP   1191 - 1260
GDQGPPGPDGPRGAPGPPGLPGSVDLLRGEPGDCGLPGPPGPPGPPGPPGYKGFPGCDGKDGQKGPVGFP   1261 - 1330
GPQGPHGFPGPPGEKGLPGPPGRKGPTGLPGPRGEPGPPADVDDCPRIPGLPGAPGMRGPEGAMGLPGMR   1331 - 1400
GPSGPGCKGEPGLDGRRGVDGVPGSPGPPGRKGDTGEDGYPGGPGPPGPIGDPGPKGFGPGYLGGFLLVL   1401 - 1470
HSQTDQEPTCPLGMPRLWTGYSLLYLEGQEKAHNQDLGLAGSCLPVFSTLPFAYCNIHQVCHYAQRNDRS   1471 - 1540
YWLASAAPLPMMPLSEEAIRPYVSRCAVCEAPAQAVAVHSQDQSIPPCPQTWRSLWIGYSFLMHTGAGDQ   1541 - 1610
GGGQALMSPGSCLEDFRAAPFLECQGRQGTCHFFANKYSFWLTTVKADLQFSSAPAPDTLKESQAQRQKI   1611 - 1680
SRCQVCVKYS                                                               1681 - 1690
//

Text Mined References (89)

PMID Year Title