Property Summary

NCBI Gene PubMed Count 14
PubMed Score 64.06
PubTator Score 7.67

Knowledge Summary


No data available


  Differential Expression (13)

 GWAS Trait (2)

Protein-protein Interaction (4)

Gene RIF (9)

26235311 Genetic analysis between COL27A1 and Tourette syndrome was performed.
24986830 Mutations in COL27A1 cause Steel syndrome and suggest a founder mutation effect in the Puerto Rican population
23192621 This study further implicates the genomic region containing the TNC and COL27A1 genes in influencing risk of Achilles tendinopathy, and maps the potential risk allele to a genetic interval flanked by rs946053 and rs2104772.
22889924 The results of this study found in rs7868992 on chromosome 9q32 within COL27A1 is releate to Tourette's syndrome.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18978678 Observational study of gene-disease association. (HuGE Navigator)
15922909 SOX9 may play an important role in the transcriptional activation of the newest collagen gene, COL27A1.
12766169 type XXVII collagen has unusual molecular features such as no minor helical domain, a major helical domain that is short and interrupted, and a short chain selection sequence within the NC1 domain
12714037 molecular cloning

AA Sequence

TLFTFRTQDPQQLPIISVDNLPPASSGKQYRLEVGPACFL                                 1821 - 1860

Text Mined References (17)

PMID Year Title
26235311 2015 Support of positive association in family-based genetic analysis between COL27A1 and Tourette syndrome.
24986830 2015 Mutations in COL27A1 cause Steel syndrome and suggest a founder mutation effect in the Puerto Rican population.
24564958 2014 Variability in the common genetic architecture of social-communication spectrum phenotypes during childhood and adolescence.
23192621 2013 Investigation of variants within the COL27A1 and TNC genes and Achilles tendinopathy in two populations.
22889924 2013 Genome-wide association study of Tourette's syndrome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18978678 2008 Candidate gene/loci studies in cleft lip/palate and dental anomalies finds novel susceptibility genes for clefts.
18391951 2008 Many sequence variants affecting diversity of adult human height.
17693149 2007 Type XXVII collagen at the transition of cartilage to bone during skeletogenesis.
15922909 2005 The new collagen gene COL27A1 contains SOX9-responsive enhancer elements.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12766169 2003 A novel and highly conserved collagen (pro(alpha)1(XXVII)) with a unique expression pattern and unusual molecular characteristics establishes a new clade within the vertebrate fibrillar collagen family.
12714037 2003 Identification, characterization and expression analysis of a new fibrillar collagen gene, COL27A1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11347906 2001 Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.