Property Summary

NCBI Gene PubMed Count 29
PubMed Score 14.73
PubTator Score 16.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Abortion, Spontaneous 93 0.0 0.0
Myasthenic Syndromes, Congenital 16 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.7
Disease Target Count Z-score Confidence
Alzheimer's disease 640 0.0 0.9
Liver disease 227 0.0 2.4
Parkinson's disease 378 0.0 1.9
Disease Target Count Z-score Confidence
Congenital myasthenic syndrome 25 0.0 4.0
Disease Target Count Z-score Confidence
Fatty liver disease 102 3.44 1.7
Disease Target Count
Myasthenic syndrome, congenital, 19 1

Expression

  Differential Expression (10)

Disease log2 FC p
cystic fibrosis 2.982 1.7e-06
ductal carcinoma in situ 1.200 6.7e-03
interstitial cystitis -1.400 3.0e-02
intraductal papillary-mucinous adenoma (... -1.200 1.4e-02
intraductal papillary-mucinous carcinoma... -1.500 3.0e-03
lung adenocarcinoma -2.200 2.1e-12
lung cancer -3.400 9.1e-05
malignant mesothelioma -3.700 1.2e-08
non-small cell lung cancer -1.549 1.4e-10
ovarian cancer 1.600 2.1e-02

 GO Function (1)

Gene RIF (10)

AA Sequence

MVAERTHKAAATGARGPGELGAPGTVALVAARAERGARLPSPGSCGLLTLALCSLALSLLAHFRTAELQA      1 - 70
RVLRLEAERGEQQMETAILGRVNQLLDEKWKLHSRRRREAPKTSPGCNCPPGPPGPTGRPGLPGDKGAIG     71 - 140
MPGRVGSPGDAGLSIIGPRGPPGQPGTRGFPGFPGPIGLDGKPGHPGPKGDMGLTGPPGQPGPQGQKGEK    141 - 210
GQCGEYPHRECLSSMPAALRSSQIIALKLLPLLNSVRLAPPPVIKRRTFQGEQSQASIQGPPGPPGPPGP    211 - 280
SGPLGHPGLPGPMGPPGLPGPPGPKGDPGIQGYHGRKGERGMPGMPGKHGAKGAPGIAVAGMKGEPGIPG    281 - 350
TKGEKGAEGSPGLPGLLGQKGEKGDAGNSIGGGRGEPGPPGLPGPPGPKGEAGVDGQVGPPGQPGDKGER    351 - 420
GAAGEQGPDGPKGSKGEPGKGEMVDYNGNINEALQEIRTLALMGPPGLPGQIGPPGAPGIPGQKGEIGLP    421 - 490
GPPGHDGEKGPRGKPGDMGPPGPQGPPGKDGPPGVKGENGHPGSPGEKGEKGETGQAGSPGEKGEAGEKG    491 - 560
NPGAEVPGLPGPEGPPGPPGLQGVPGPKGEAGLDGAKGEKGFQGEKGDRGPLGLPGASGLDGRPGPPGTP    561 - 630
GPIGVPGPAGPKGERGSKGDPGMTGPTGAAGLPGLHGPPGDKGNRGERGKKGSRGPKGDKGDQGAPGLDA    631 - 700
PCPLGEDGLPVQGCWNK                                                         701 - 717
//

Text Mined References (31)

PMID Year Title