Property Summary

NCBI Gene PubMed Count 37
PubMed Score 21.45
PubTator Score 28.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 1.4
Kidney cancer 2548 0.0 1.0
Liver cancer 589 0.0 0.7
Disease Target Count Z-score Confidence
Ehlers-Danlos syndrome 43 0.0 5.0
Disease Target Count Z-score Confidence
Congenital muscular dystrophy 29 0.0 4.0
Disease Target Count Z-score Confidence
Exostosis 15 3.989 2.0
Fibroma 18 3.191 1.6

Expression

  Differential Expression (27)

Disease log2 FC p
Breast cancer 2.000 3.4e-02
acute quadriplegic myopathy 1.173 3.4e-03
adrenocortical carcinoma -1.886 2.2e-04
astrocytic glioma -1.200 5.9e-03
Astrocytoma, Pilocytic 1.100 1.8e-02
Atopic dermatitis -1.500 6.6e-04
atypical teratoid / rhabdoid tumor 1.500 4.5e-02
autosomal dominant Emery-Dreifuss muscul... 1.483 8.2e-03
breast carcinoma 1.500 1.7e-11
cystic fibrosis 1.400 1.6e-03
Duchenne muscular dystrophy 1.267 3.2e-05
fascioscapulohumeral muscular dystrophy 1.278 1.7e-04
fibroadenoma -1.300 2.6e-02
gastric carcinoma 2.400 1.2e-02
group 4 medulloblastoma -2.100 7.3e-06
invasive ductal carcinoma 1.446 2.2e-02
lung carcinoma -1.500 3.7e-14
nasopharyngeal carcinoma 1.400 2.6e-02
non-small cell lung cancer 2.335 3.0e-12
osteosarcoma 2.351 8.3e-03
ovarian cancer 2.000 1.3e-02
pancreatic cancer 2.000 1.7e-04
pituitary cancer -1.500 2.3e-04
primary pancreatic ductal adenocarcinoma 4.496 5.9e-05
ulcerative colitis 3.400 5.3e-04
urothelial carcinoma 2.500 1.1e-03
X-linked cerebral adrenoleukodystrophy 1.300 3.6e-02

Gene RIF (15)

AA Sequence

MRSRLPPALAALGAALLLSSIEAEVDPPSDLNFKIIDENTVHMSWAKPVDPIVGYRITVDPTTDGPTKEF      1 - 70
TLSASTTETLLSELVPETEYVVTITSYDEVEESVPVIGQLTIQTGSSTKPVEKKPGKTEIQKCSVSAWTD     71 - 140
LVFLVDGSWSVGRNNFKYILDFIAALVSAFDIGEEKTRVGVVQYSSDTRTEFNLNQYYQRDELLAAIKKI    141 - 210
PYKGGNTMTGDAIDYLVKNTFTESAGARVGFPKVAIIITDGKSQDEVEIPARELRNVGVEVFSLGIKAAD    211 - 280
AKELKQIASTPSLNHVFNVANFDAIVDIQNEIISQVCSGVDEQLGELVSGEEVVEPPSNLIAMEVSSKYV    281 - 350
KLNWNPSPSPVTGYKVILTPMTAGSRQHALSVGPQTTTLSVRDLSADTEYQISVSAMKGMTSSEPISIME    351 - 420
KTQPMKVQVECSRGVDIKADIVFLVDGSYSIGIANFVKVRAFLEVLVKSFEISPNRVQISLVQYSRDPHT    421 - 490
EFTLKKFTKVEDIIEAINTFPYRGGSTNTGKAMTYVREKIFVPSKGSRSNVPKVMILITDGKSSDAFRDP    491 - 560
AIKLRNSDVEIFAVGVKDAVRSELEAIASPPAETHVFTVEDFDAFQRISFELTQSICLRIEQELAAIKKK    561 - 630
AYVPPKDLSFSEVTSYGFKTNWSPAGENVFSYHITYKEAAGDDEVTVVEPASSTSVVLSSLKPETLYLVN    631 - 700
VTAEYEDGFSIPLAGEETTEEVKGAPRNLKVTDETTDSFKITWTQAPGRVLRYRIIYRPVAGGESREVTT    701 - 770
PPNQRRRTLENLIPDTKYEVSVIPEYFSGPGTPLTGNAATEEVRGNPRDLRVSDPTTSTMKLSWSGAPGK    771 - 840
VKQYLVTYTPVAGGETQEVTVRGDTTNTVLQGLKEGTQYALSVTALYASGAGDALFGEGTTLEERGSPQD    841 - 910
LVTKDITDTSIGAYWTSAPGMVRGYRVSWKSLYDDVDTGEKNLPEDAIHTMIENLQPETKYRISVFATYS    911 - 980
SGEGEPLTGDATTELSQDSKTLKVDEETENTMRVTWKPAPGKVVNYRVVYRPHGRGKQMVAKVPPTVTST    981 - 1050
VLKRLQPQTTYDITVLPIYKMGEGKLRQGSGTTASRFKSPRNLKTSDPTMSSFRVTWEPAPGEVKGYKVT   1051 - 1120
FHPTGDDRRLGELVVGPYDNTVVLEELRAGTTYKVNVFGMFDGGESSPLVGQEMTTLSDTTVMPILSSGM   1121 - 1190
ECLTRAEADIVLLVDGSWSIGRANFRTVRSFISRIVEVFDIGPKRVQIALAQYSGDPRTEWQLNAHRDKK   1191 - 1260
SLLQAVANLPYKGGNTLTGMALNFIRQQNFRTQAGMRPRARKIGVLITDGKSQDDVEAPSKKLKDEGVEL   1261 - 1330
FAIGIKNADEVELKMIATDPDDTHAYNVADFESLSRIVDDLTINLCNSVKGPGDLEAPSNLVISERTHRS   1331 - 1400
FRVSWTPPSDSVDRYKVEYYPVSGGKRQEFYVSRMETSTVLKDLKPETEYVVNVYSVVEDEYSEPLKGTE   1401 - 1470
KTLPVPVVSLNIYDVGPTTMHVQWQPVGGATGYILSYKPVKDTEPTRPKEVRLGPTVNDMQLTDLVPNTE   1471 - 1540
YAVTVQAVLHDLTSEPVTVREVTLPLPRPQDLKLRDVTHSTMNVFWEPVPGKVRKYIVRYKTPEEDVKEV   1541 - 1610
EVDRSETSTSLKDLFSQTLYTVSVSAVHDEGESPPVTAQETTRPVPAPTNLKITEVTSEGFRGTWDHGAS   1611 - 1680
DVSLYRITWAPFGSSDKMETILNGDENTLVFENLNPNTIYEVSITAIYPDESESDDLIGSERTLPILTTQ   1681 - 1750
APKSGPRNLQVYNATSNSLTVKWDPASGRVQKYRITYQPSTGEGNEQTTTIGGRQNSVVLQKLKPDTPYT   1751 - 1820
ITVSSLYPDGEGGRMTGRGKTKPLNTVRNLRVYDPSTSTLNVRWDHAEGNPRQYKLFYAPAAGGPEELVP   1821 - 1890
IPGNTNYAILRNLQPDTSYTVTVVPVYTEGDGGRTSDTGRTLMRGLARNVQVYNPTPNSLDVRWDPAPGP   1891 - 1960
VLQYRVVYSPVDGTRPSESIVVPGNTRMVHLERLIPDTLYSVNLVALYSDGEGNPSPAQGRTLPRSGPRN   1961 - 2030
LRVFGETTNSLSVAWDHADGPVQQYRIIYSPTVGDPIDEYTTVPGRRNNVILQPLQPDTPYKITVIAVYE   2031 - 2100
DGDGGHLTGNGRTVGLLPPQNIHISDEWYTRFRVSWDPSPSPVLGYKIVYKPVGSNEPMEAFVGEMTSYT   2101 - 2170
LHNLNPSTTYDVNVYAQYDSGLSVPLTDQGTTLYLNVTDLKTYQIGWDTFCVKWSPHRAATSYRLKLSPA   2171 - 2240
DGTRGQEITVRGSETSHCFTGLSPDTDYGVTVFVQTPNLEGPGVSVKEHTTVKPTEAPTEPPTPPPPPTI   2241 - 2310
PPARDVCKGAKADIVFLTDASWSIGDDNFNKVVKFIFNTVGGFDEISPAGIQVSFVQYSDEVKSEFKLNT   2311 - 2380
YNDKALALGALQNIRYRGGNTRTGKALTFIKEKVLTWESGMRKNVPKVLVVVTDGRSQDEVKKAALVIQQ   2381 - 2450
SGFSVFVVGVADVDYNELANIASKPSERHVFIVDDFESFEKIEDNLITFVCETATSSCPLIYLDGYTSPG   2451 - 2520
FKMLEAYNLTEKNFASVQGVSLESGSFPSYSAYRIQKNAFVNQPTADLHPNGLPPSYTIILLFRLLPETP   2521 - 2590
SDPFAIWQITDRDYKPQVGVIADPSSKTLSFFNKDTRGEVQTVTFDTEEVKTLFYGSFHKVHIVVTSKSV   2591 - 2660
KIYIDCYEIIEKDIKEAGNITTDGYEILGKLLKGERKSAAFQIQSFDIVCSPVWTSRDRCCDIPSRRDEG   2661 - 2730
KCPAFPNSCTCTQDSVGPPGPPGPAGGPGAKGPRGERGISGAIGPPGPRGDIGPPGPQGPPGPQGPNGLS   2731 - 2800
IPGEQGRQGMKGDAGEPGLPGRTGTPGLPGPPGPMGPPGDRGFTGKDGAMGPRGPPGPPGSPGSPGVTGP   2801 - 2870
SGKPGKPGDHGRPGPSGLKGEKGDRGDIASQNMMRAVARQVCEQLISGQMNRFNQMLNQIPNDYQSSRNQ   2871 - 2940
PGPPGPPGPPGSAGARGEPGPGGRPGFPGTPGMQGPPGERGLPGEKGERGTGSSGPRGLPGPPGPQGESR   2941 - 3010
TGPPGSTGSRGPPGPPGRPGNSGIRGPPGPPGYCDSSQCASIPYNGQGYPGSG                    3011 - 3063
//

Text Mined References (42)

PMID Year Title