Property Summary

NCBI Gene PubMed Count 23
PubMed Score 8.17
PubTator Score 10.06

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 1.200 1.7e-03
osteosarcoma -3.083 1.3e-09
limb girdle muscular dystrophy 2I -1.053 2.6e-03
lung cancer -1.100 3.6e-02
ovarian cancer 1.500 3.4e-03

 GWAS Trait (1)

Gene RIF (8)

PMID Text
25331899 Cog5-Cog7 crystal structure reveals interactions essential for the function of a multisubunit tethering complex.
25179963 Targeted silencing of components of lobe B of the COG complex, namely COG5, COG6, COG7 and COG8, inhibited HIV-1 replication
22615457 In conclusion, we find that GDF5, but not COG5 or MCF2L, influence the extent of radiographic damage in knee osteoarthritis
21068099 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20804914 Report on a uterine leiomyoma with a novel HMGA2 fusion gene in a 44-year-old woman.
20112360 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
16051600 COG5- and COG7 subunits play distinctive roles in controlling Golgi structure and function
11929878 Sec34 is implicated in traffic from the endoplasmic reticulum to the Golgi and exists in a complex with GTC-90 and ldlBp

AA Sequence

MGWVGGRRRDSASPPGRSRSAADDINPAPANMEGGGGSVAVAGLGARGSGAAAATVRELLQDGCYSDFLN      1 - 70
EDFDVKTYTSQSIHQAVIAEQLAKLAQGISQLDRELHLQVVARHEDLLAQATGIESLEGVLQMMQTRIGA     71 - 140
LQGAVDRIKAKIVEPYNKIVARTAQLARLQVACDLLRRIIRILNLSKRLQGQLQGGSREITKAAQSLNEL    141 - 210
DYLSQGIDLSGIEVIENDLLFIARARLEVENQAKRLLEQGLETQNPTQVGTALQVFYNLGTLKDTITSVV    211 - 280
DGYCATLEENINSALDIKVLTQPSQSAVRGGPGRSTMPTPGNTAALRASFWTNMEKLMDHIYAVCGQVQH    281 - 350
LQKVLAKKRDPVSHICFIEEIVKDGQPEIFYTFWNSVTQALSSQFHMATNSSMFLKQAFEGEYPKLLRLY    351 - 420
NDLWKRLQQYSQHIQGNFNASGTTDLYVDLQHMEDDAQDIFIPKKPDYDPEKALKDSLQPYEAAYLSKSL    421 - 490
SRLFDPINLVFPPGGRNPPSSDELDGIIKTIASELNVAAVDTNLTLAVSKNVAKTIQLYSVKSEQLLSTQ    491 - 560
GDASQVIGPLTEGQRRNVAVVNSLYKLHQSVTKAIHALMENAVQPLLTSVGDAIEAIIITMHQEDFSGSL    561 - 630
SSSGKPDVPCSLYMKELQGFIARVMSDYFKHFECLDFVFDNTEAIAQRAVELFIRHASLIRPLGEGGKMR    631 - 700
LAADFAQMELAVGPFCRRVSDLGKSYRMLRSFRPLLFQASEHVASSPALGDVIPFSIIIQFLFTRAPAEL    701 - 770
KSPFQRAEWSHTRFSQWLDDHPSEKDRLLLIRGALEAYVQSVRSREGKEFAPVYPIMVQLLQKAMSALQ     771 - 839
//

Text Mined References (28)

PMID Year Title
25331899 2014 Cog5-Cog7 crystal structure reveals interactions essential for the function of a multisubunit tethering complex.
25179963 2014 Target silencing of components of the conserved oligomeric Golgi complex impairs HIV-1 replication.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22615457 2012 Genetic contribution to radiographic severity in osteoarthritis of the knee.
21269460 2011 Initial characterization of the human central proteome.
21068099 2011 Meta-analysis of genome-wide association studies confirms a susceptibility locus for knee osteoarthritis on chromosome 7q22.
20804914 2010 Fusion of HMGA2 to COG5 in uterine leiomyoma.
20112360 2010 A genome-wide association study identifies an osteoarthritis susceptibility locus on chromosome 7q22.
19946888 2010 Defining the membrane proteome of NK cells.
19690088 2009 Deficiency in COG5 causes a moderate form of congenital disorders of glycosylation.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18353293 2008 Role of the conserved oligomeric Golgi (COG) complex in protein glycosylation.
18088087 2008 Phosphoproteome of resting human platelets.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17356545 2007 A common mutation in the COG7 gene with a consistent phenotype including microcephaly, adducted thumbs, growth retardation, VSD and episodes of hyperthermia.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16051600 2005 Genetic analysis of the subunit organization and function of the conserved oligomeric golgi (COG) complex: studies of COG5- and COG7-deficient mammalian cells.
16020545 2005 Subunit architecture of the conserved oligomeric Golgi complex.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15047703 2004 The binary interacting network of the conserved oligomeric Golgi tethering complex.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11980916 2002 Characterization of a mammalian Golgi-localized protein complex, COG, that is required for normal Golgi morphology and function.
11929878 2002 Sec34 is implicated in traffic from the endoplasmic reticulum to the Golgi and exists in a complex with GTC-90 and ldlBp.
10782044 2000 The familial mediterranean fever protein interacts and colocalizes with a putative Golgi transporter.
9792665 1998 Purification and characterization of a novel 13 S hetero-oligomeric protein complex that stimulates in vitro Golgi transport.