Property Summary

NCBI Gene PubMed Count 61
PubMed Score 315.53
PubTator Score 142.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Deafness, Autosomal Dominant 9 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Nonsyndromic deafness 142 6.695 3.3

Expression

  Differential Expression (24)

Disease log2 FC p
adrenocortical adenoma -1.412 4.4e-03
adrenocortical carcinoma -1.592 5.9e-07
astrocytic glioma -1.300 7.1e-03
Atopic dermatitis -2.600 3.8e-04
atypical teratoid / rhabdoid tumor 1.700 2.0e-02
cystic fibrosis -1.300 3.4e-03
ependymoma -1.500 1.0e-02
gastric cancer 1.100 2.4e-02
group 3 medulloblastoma 2.900 9.1e-05
interstitial cystitis 1.600 2.3e-02
intraductal papillary-mucinous adenoma (... -2.800 3.1e-03
intraductal papillary-mucinous carcinoma... -2.100 2.2e-02
lung adenocarcinoma 1.200 1.7e-03
lung cancer 3.000 2.3e-05
malignant mesothelioma 4.300 1.4e-09
medulloblastoma, large-cell 2.500 3.1e-03
non-small cell lung cancer 1.713 1.1e-08
oligodendroglioma -1.300 7.2e-03
ovarian cancer 1.100 7.2e-04
pancreatic cancer -1.600 1.2e-02
primary pancreatic ductal adenocarcinoma -1.105 2.3e-02
psoriasis -1.500 4.3e-04
subependymal giant cell astrocytoma -1.215 3.7e-02
Waldenstrons macroglobulinemia -1.572 3.2e-03

Gene RIF (43)

AA Sequence

MSAAWIPALGLGVCLLLLPGPAGSEGAAPIAITCFTRGLDIRKEKADVLCPGGCPLEEFSVYGNIVYASV      1 - 70
SSICGAAVHRGVISNSGGPVRVYSLPGRENYSSVDANGIQSQMLSRWSASFTVTKGKSSTQEATGQAVST     71 - 140
AHPPTGKRLKKTPEKKTGNKDCKADIAFLIDGSFNIGQRRFNLQKNFVGKVALMLGIGTEGPHVGLVQAS    141 - 210
EHPKIEFYLKNFTSAKDVLFAIKEVGFRGGNSNTGKALKHTAQKFFTVDAGVRKGIPKVVVVFIDGWPSD    211 - 280
DIEEAGIVAREFGVNVFIVSVAKPIPEELGMVQDVTFVDKAVCRNNGFFSYHMPNWFGTTKYVKPLVQKL    281 - 350
CTHEQMMCSKTCYNSVNIAFLIDGSSSVGDSNFRLMLEFVSNIAKTFEISDIGAKIAAVQFTYDQRTEFS    351 - 420
FTDYSTKENVLAVIRNIRYMSGGTATGDAISFTVRNVFGPIRESPNKNFLVIVTDGQSYDDVQGPAAAAH    421 - 490
DAGITIFSVGVAWAPLDDLKDMASKPKESHAFFTREFTGLEPIVSDVIRGICRDFLESQQ              491 - 550
//

Text Mined References (64)

PMID Year Title