Property Summary

NCBI Gene PubMed Count 26
PubMed Score 145.17
PubTator Score 25.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 1.300 1.9e-04
malignant mesothelioma 1.100 5.9e-06
osteosarcoma -1.455 1.4e-05

 GWAS Trait (1)

Protein-protein Interaction (9)

Gene RIF (10)

AA Sequence

MAVFRSGLLVLTTPLASLAPRLASILTSAARLVNHTLYVHLQPGMSLEGPAQPQSSPVQATFEVLDFITH      1 - 70
LYAGADVHRHLDVRILLTNIRTKSTFLPPLPTSVQNLAHPPEVVLTDFQTLDGSQYNPVKQQLVRYATSC     71 - 140
YSCCPRLASVLLYSDYGIGEVPVEPLDVPLPSTIRPASPVAGSPKQPVRGYYRGAVGGTFDRLHNAHKVL    141 - 210
LSVACILAQEQLVVGVADKDLLKSKLLPELLQPYTERVEHLSEFLVDIKPSLTFDVIPLLDPYGPAGSDP    211 - 280
SLEFLVVSEETYRGGMAINRFRLENDLEELALYQIQLLKDLRHTENEEDKVSSSSFRQRMLGNLLRPPYE    281 - 350
RPELPTCLYVIGLTGISGSGKSSIAQRLKGLGAFVIDSDHLGHRAYAPGGPAYQPVVEAFGTDILHKDGI    351 - 420
INRKVLGSRVFGNKKQLKILTDIMWPIIAKLAREEMDRAVAEGKRVCVIDAAVLLEAGWQNLVHEVWTAV    421 - 490
IPETEAVRRIVERDGLSEAAAQSRLQSQMSGQQLVEQSHVVLSTLWEPHITQRQVEKAWALLQKRIPKTH    491 - 560
QALD                                                                      561 - 564
//

Text Mined References (31)

PMID Year Title