Property Summary

NCBI Gene PubMed Count 5
PubMed Score 6.90
PubTator Score 2.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
acute myeloid leukemia -1.200 4.3e-02
medulloblastoma, large-cell -1.200 6.1e-04
osteosarcoma -1.372 1.4e-04
pancreatic ductal adenocarcinoma liver m... -1.050 4.6e-03

Pathway (1)

Gene RIF (2)

AA Sequence

MPKYYEDKPQGGACAGLKEDLGACLLQSDCVVQEGKSPRQCLKEGYCNSLKYAFFECKRSVLDNRARFRG      1 - 70
RKGY                                                                       71 - 74
//

Text Mined References (8)

PMID Year Title