Property Summary

NCBI Gene PubMed Count 7
PubMed Score 12.34
PubTator Score 7.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung cancer 4473 5.7e-05
ovarian cancer 8491 1.1e-04
non primary Sjogren syndrome sicca 840 1.8e-02

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 1.700 5.7e-05
non primary Sjogren syndrome sicca 1.500 1.8e-02
ovarian cancer 1.300 1.1e-04

Synonym

Accession Q9NYJ1 B2RAA0 Q69YU4
Symbols CMC3
E2IG2
CHCHD8

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MSTSVPQGHTWTQRVKKDDEEEDPLDQLISRSGCAASHFAVQECMAQHQDWRQCQPQVQAFKDCMSEQQA      1 - 70
RRQEELQRRQEQAGAHH                                                          71 - 87
//

Text Mined References (13)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20624914 2010 Analysis of Leigh syndrome mutations in the yeast SURF1 homolog reveals a new member of the cytochrome oxidase assembly factor family.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11085516 2000 Effects of estrogen on global gene expression: identification of novel targets of estrogen action.
11076863 2000 DNA cloning using in vitro site-specific recombination.