Property Summary

NCBI Gene PubMed Count 23
PubMed Score 23.42
PubTator Score 9.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
primary pancreatic ductal adenocarcinoma -1.508 2.1e-02
adult high grade glioma -1.200 3.3e-04
non primary Sjogren syndrome sicca 1.300 1.0e-02
ovarian cancer -1.400 1.5e-08
pancreatic cancer -1.400 4.2e-03

Gene RIF (13)

PMID Text
26083938 cytoplasmic centrobin has roles in noncentrosomal microtubule formation in specific cell types and during the cell cycle
25616662 Centrobin plays a role in the stability and centriole elongation function of CPAP and limits the centriole length.
24700465 Centrobin-CPAP interaction is critical for the recruitment of CPAP to procentrioles to promote the elongation of daughter centrioles and for the persistence of CPAP on preexisting mother centrioles.
23442802 it is proposed that Centrobin might regulate microtubule nucleation and organization by controlling the amount of pericentriolar matrix
23291182 NEK2 phosphorylation antagonizes the microtubule stabilizing activity of centrobin.
23001753 Our results indicate that genetic polymorphisms of centrobin and Nek2 are related to breast cancer susceptibility in Chinese Han women.
21576394 Centrobin facilitates the elongation and stability of centrioles via its interaction with tubulins.
20511645 Data propose that centrobin functions as a microtubule stabilizing factor and PLK1 enhances centrobin activity for proper spindle formation during mitosis.
20508983 Observational study of gene-disease association. (HuGE Navigator)
20190801 a requirement of Centrobin in maintaining centrosome integrity, which in turn promotes anchoring of mitotic spindle to the centrosomes.
20085806 Inhibition of p38 activity or downregulation of p38 expression could overcome the cell-cycle arrest caused by centrobin depletion.
17535851 Results report that NIP2, previously identified as centrobin, is a novel substrate of Nek2, and that NIP2 has a role in stabilizing the microtubule structure.
16275750 Centrobin is a centriole-associated protein that asymmetrically localizes to the daughter centriole.

AA Sequence

MATSADSPSSPLGAEDLLSDSSEPPGLNQVSSEVTSQLYASLRLSRQAEATARAQLYLPSTSPPHEGLDG      1 - 70
FAQELSRSLSVGLEKNLKKKDGSKHIFEMESVRGQLQTMLQTSRDTAYRDPLIPGAGSERREEDSFDSDS     71 - 140
TATLLNTRPLQDLSPSSSAQALEELFPRYTSLRPGPPLNPPDFQGLRDALDSEHTRRKHCERHIQSLQTR    141 - 210
VLELQQQLAVAVAADRKKDTMIEQLDKTLARVVEGWNRHEAERTEVLRGLQEEHQAAELTRSKQQETVTR    211 - 280
LEQSLSEAMEALNREQESARLQQRERETLEEERQALTLRLEAEQQRCCVLQEERDAARAGQLSEHRELET    281 - 350
LRAALEEERQTWAQQEHQLKEHYQALQEESQAQLEREKEKSQREAQAAWETQHQLALVQSEVRRLEGELD    351 - 420
TARRERDALQLEMSLVQARYESQRIQLESELAVQLEQRVTERLAQAQESSLRQAASLREHHRKQLQDLSG    421 - 490
QHQQELASQLAQFKVEMAEREERQQQVAEDYELRLAREQARVCELQSGNQQLEEQRVELVERLQAMLQAH    491 - 560
WDEANQLLSTTLPPPNPPAPPAGPSSPGPQEPEKEERRVWTMPPMAVALKPVLQQSREARDELPGAPPVL    561 - 630
CSSSSDLSLLLGPSFQSQHSFQPLEPKPDLTSSTAGAFSALGAFHPDHRAERPFPEEDPGPDGEGLLKQG    631 - 700
LPPAQLEGLKNFLHQLLETVPQNNENPSVDLLPPKSGPLTVPSWEEAPQVPRIPPPVHKTKVPLAMASSL    701 - 770
FRVPEPPSSHSQGSGPSSGSPERGGDGLTFPRQLMEVSQLLRLYQARGWGALPAEDLLLYLKRLEHSGTD    771 - 840
GRGDNVPRRNTDSRLGEIPRKEIPSQAVPRRLATAPKTEKPPARKKSGHPAPSSMRSRGGVWR           841 - 903
//

Text Mined References (27)

PMID Year Title
26083938 2015 The microtubule nucleation activity of centrobin in both the centrosome and cytoplasm.
25616662 2015 Centrobin-mediated regulation of the centrosomal protein 4.1-associated protein (CPAP) level limits centriole length during elongation stage.
25416956 2014 A proteome-scale map of the human interactome network.
24700465 2014 Centrobin-centrosomal protein 4.1-associated protein (CPAP) interaction promotes CPAP localization to the centrioles during centriole duplication.
23442802 2013 Centrobin regulates centrosome function in interphase cells by limiting pericentriolar matrix recruitment.
23291182 2013 NEK2 phosphorylation antagonizes the microtubule stabilizing activity of centrobin.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23001753 2012 Genetic polymorphisms in centrobin and Nek2 are associated with breast cancer susceptibility in a Chinese Han population.
21576394 2011 Centrobin-tubulin interaction is required for centriole elongation and stability.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
20511645 2010 Centrobin/NIP2 is a microtubule stabilizer whose activity is enhanced by PLK1 phosphorylation during mitosis.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
20190801 2010 Centrobin regulates the assembly of functional mitotic spindles.
20085806 2010 Inhibition of centriole duplication by centrobin depletion leads to p38-p53 mediated cell-cycle arrest.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17535851 2007 Characterization of NIP2/centrobin, a novel substrate of Nek2, and its potential role in microtubule stabilization.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16275750 2005 Centrobin: a novel daughter centriole-associated protein that is required for centriole duplication.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11984006 2002 The Chediak-Higashi protein interacts with SNARE complex and signal transduction proteins.