Property Summary

NCBI Gene PubMed Count 17
PubMed Score 0.00
PubTator Score 1.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.500 4.5e-02
ependymoma -2.900 1.8e-21
glioblastoma -2.100 4.2e-05
group 3 medulloblastoma -2.400 2.7e-04
atypical teratoid/rhabdoid tumor -1.800 6.5e-06
medulloblastoma, large-cell -2.100 1.5e-06
pediatric high grade glioma -1.900 2.1e-06
pilocytic astrocytoma -2.200 3.1e-08
subependymal giant cell astrocytoma -3.050 2.7e-03
Pick disease -1.100 2.4e-02
progressive supranuclear palsy -1.400 6.5e-03
psoriasis -1.200 1.7e-08

Gene RIF (5)

PMID Text
24223195 This study is the first demonstration for association of the CNTNAP4 gene and one of its intronic CNV polymorphisms with aging.
22661486 A quantitative analysis of central corneal thickness and a subsequent analysis of primary open-angle glaucoma (POAG), SNPs in two cell adhesion molecules, NTM and CNTNAP4, were identified and may increase POAG susceptibility in a subset of cases.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19844255 Observational study of gene-disease association. (HuGE Navigator)
18398821 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGSVTGAVLKTLLLLSTQNWNRVEAGNSYDCDDPLVSALPQASFSSSSELSSSHGPGFARLNRRDGAGGW      1 - 70
SPLVSNKYQWLQIDLGERMEVTAVATQGGYGSSNWVTSYLLMFSDSGWNWKQYRQEDSIWGFSGNANADS     71 - 140
VVYYRLQPSIKARFLRFIPLEWNPKGRIGMRIEVFGCAYRSEVVDLDGKSSLLYRFDQKSLSPIKDIISL    141 - 210
KFKTMQSDGILLHREGPNGDHITLQLRRARLFLLINSGEAKLPSTSTLVNLTLGSLLDDQHWHSVLIQRL    211 - 280
GKQVNFTVDEHRHHFHARGEFNLMNLDYEISFGGIPAPGKSVSFPHRNFHGCLENLYYNGVDIIDLAKQQ    281 - 350
KPQIIAMGNVSFSCSQPQSMPVTFLSSRSYLALPDFSGEEEVSATFQFRTWNKAGLLLFSELQLISGGIL    351 - 420
LFLSDGKLKSNLYQPGKLPSDITAGVELNDGQWHSVSLSAKKNHLSVAVDGQMASAAPLLGPEQIYSGGT    421 - 490
YYFGGCPDKSFGSKCKSPLGGFQGCMRLISISGKVVDLISVQQGSLGNFSDLQIDSCGISDRCLPNYCEH    491 - 560
GGECSQSWSTFHCNCTNTGYRGATCHNSIYEQSCEAYKHRGNTSGFYYIDSDGSGPLEPFLLYCNMTETA    561 - 630
WTIIQHNGSDLTRVRNTNPENPYAGFFEYVASMEQLQATINRAEHCEQEFTYYCKKSRLVNKQDGTPLSW    631 - 700
WVGRTNETQTYWGGSSPDLQKCTCGLEGNCIDSQYYCNCDADRNEWTNDTGLLAYKEHLPVTKIVITDTG    701 - 770
RLHSEAAYKLGPLLCQGDRSFWNSASFDTEASYLHFPTFHGELSADVSFFFKTTASSGVFLENLGIADFI    771 - 840
RIELRSPTVVTFSFDVGNGPFEISVQSPTHFNDNQWHHVRVERNMKEASLQVDQLTPKTQPAPADGHVLL    841 - 910
QLNSQLFVGGTATRQRGFLGCIRSLQLNGMTLDLEERAQVTPEVQPGCRGHCSSYGKLCRNGGKCRERPI    911 - 980
GFFCDCTFSAYTGPFCSNEISAYFGSGSSVIYNFQENYLLSKNSSSHAASFHGDMKLSREMIKFSFRTTR    981 - 1050
TPSLLLFVSSFYKEYLSVIIAKNGSLQIRYKLNKYQEPDVVNFDFKNMADGQLHHIMINREEGVVFIEID   1051 - 1120
DNRRRQVHLSSGTEFSAVKSLVLGRILEHSDVDQDTALAGAQGFTGCLSAVQLSHVAPLKAALHPSHPDP   1121 - 1190
VTVTGHVTESSCMAQPGTDATSRERTHSFADHSGTIDDREPLANAIKSDSAVIGGLIAVVIFILLCITAI   1191 - 1260
AVRIYQQKRLYKRSEAKRSENVDSAEAVLKSELNIQNAVNENQKEYFF                         1261 - 1308
//

Text Mined References (20)

PMID Year Title
24811271 2014 Genome-wide SNP associations with rubella-specific cytokine responses in measles-mumps-rubella vaccine recipients.
24223195 2013 A common copy number variation (CNV) polymorphism in the CNTNAP4 gene: association with aging in females.
23395182 2013 The structure of the Tiam1 PDZ domain/ phospho-syndecan1 complex reveals a ligand conformation that modulates protein dynamics.
22952603 2012 Genome-wide association study of d-amphetamine response in healthy volunteers identifies putative associations, including cadherin 13 (CDH13).
22661486 2012 Genome-wide analysis of central corneal thickness in primary open-angle glaucoma cases in the NEIGHBOR and GLAUGEN consortia.
22569225 2012 Investigation of single nucleotide polymorphisms and biological pathways associated with response to TNF? inhibitors in patients with rheumatoid arthritis.
22359512 2012 Genome-wide association study identifies novel loci associated with circulating phospho- and sphingolipid concentrations.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20361982 2010 The Tiam1 PDZ domain couples to Syndecan1 and promotes cell-matrix adhesion.
19844255 2010 Fine mapping and association studies of a high-density lipoprotein cholesterol linkage region on chromosome 16 in French-Canadian subjects.
18398821 2008 Genome-wide analysis identifies 16q deletion associated with survival, molecular subtypes, mRNA expression, and germline haplotypes in breast cancer patients.
17213182 2006 Identification of genes related to Parkinson's disease using expressed sequence tags.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421765 2002 Protein-protein interactions between large proteins: two-hybrid screening using a functionally classified library composed of long cDNAs.
12093160 2002 Caspr3 and caspr4, two novel members of the caspr family are expressed in the nervous system and interact with PDZ domains.
11214970 2000 Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
7757816 1995 [IMAGE: molecular integration of the analysis of the human genome and its expression].