Property Summary

NCBI Gene PubMed Count 21
PubMed Score 101.34
PubTator Score 15.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
ependymoma -1.400 6.5e-17
glioblastoma -1.200 1.5e-08
medulloblastoma, large-cell -1.100 4.2e-04
non-small cell lung carcinoma -1.800 5.3e-28
lung cancer -1.700 5.5e-04
lung adenocarcinoma -2.500 9.8e-23
pediatric high grade glioma -1.300 6.5e-08
atypical teratoid/rhabdoid tumor -1.200 3.1e-05
group 3 medulloblastoma -1.300 3.4e-04
lung carcinoma -2.300 6.1e-21
pituitary cancer 1.500 3.4e-03
psoriasis -1.800 1.2e-15

Gene RIF (5)

PMID Text
21079607 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20398908 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19509545 results do not support the candidacy of CHL1, CNTN6, and CNTN4 as tumor suppressor genes in the 3p26-pter region in ovarian cancer
19086053 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MRLLWKLVILLPLINSSAGDGLLSRPIFTQEPHDVIFPLDLSKSEVILNCAANGYPSPHYRWKQNGTDID      1 - 70
FTMSYHYRLDGGSLAINSPHTDQDIGMYQCLATNLLGTILSRKAKLQFAYIEDFETKTRSTVSVREGQGV     71 - 140
VLLCGPPPHFGDLSYAWTFNDNPLYVQEDNRRFVSQETGNLYIAKVEPSDVGNYTCFITNKEAQRSVQGP    141 - 210
PTPLVQRTDGVMGEYEPKIEVRFPETIQAAKDSSVKLECFALGNPVPDISWRRLDGSPLPGKVKYSKSQA    211 - 280
ILEIPNFQQEDEGFYECIASNLRGRNLAKGQLIFYAPPEWEQKIQNTHLSIYDNLLWECKASGKPNPWYT    281 - 350
WLKNGERLNPEERIQIENGTLIITMLNVSDSGVYQCAAENKYQIIYANAELRVLASAPDFSKSPVKKKSF    351 - 420
VQVGGDIVIGCKPNAFPRAAISWKRGTETLRQSKRIFLLEDGSLKIYNITRSDAGSYTCIATNQFGTAKN    421 - 490
TGSLIVKERTVITVPPSKMDVTVGESIVLPCQVSHDPSIEVVFVWFFNGDVIDLKKGVAHFERIGGESVG    491 - 560
DLMIRNIQLHHSGKYLCTVQTTLESLSAVADIIVRGPPGPPEDVQVEDISSTTSQLSWRAGPDNNSPIQI    561 - 630
FTIQTRTPFSVGWQAVATVPEILNGKTYNATVVGLSPWVEYEFRVVAGNSIGIGEPSEPSELLRTKASVP    631 - 700
VVAPVNIHGGGGSRSELVITWESIPEELQNGEGFGYIIMFRPVGSTTWSKEKVSSVESSRFVYRNESIIP    701 - 770
LSPFEVKVGVYNNEGEGSLSTVTIVYSGEDEPQLAPRGTSLQSFSASEMEVSWNAIAWNRNTGRVLGYEV    771 - 840
LYWTDDSKESMIGKIRVSGNVTTKNITGLKANTIYFASVRAYNTAGTGPSSPPVNVTTKKSPPSQPPANI    841 - 910
AWKLTNSKLCLNWEHVKTMENESEVLGYKILYRQNRQSKTHILETNNTSAELLVPFEEDYLIEIRTVSDG    911 - 980
GDGSSSEEIRIPKMSSLSSRGIQFLEPSTHFLSIVIVIFHCFAIQPLI                          981 - 1028
//

Text Mined References (25)

PMID Year Title
24871463 2014 GWAS identifies novel SLE susceptibility genes and explains the association of the HLA region.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
23872404 2013 Contactins in the neurobiology of autism.
23650146 2013 A genome-wide association study for venous thromboembolism: the extended cohorts for heart and aging research in genomic epidemiology (CHARGE) consortium.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
22219177 2012 A genome-wide search for loci interacting with known prostate cancer risk-associated genetic variants.
22205951 2011 Genome-wide association study in bipolar patients stratified by co-morbidity.
21220648 2011 Resequencing of 29 candidate genes in patients with familial and sporadic amyotrophic lateral sclerosis.
21079607 2011 A genome-wide association study on common SNPs and rare CNVs in anorexia nervosa.
20398908 2010 Comprehensive copy number variant (CNV) analysis of neuronal pathways genes in psychiatric disorders identifies rare variants within patients.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20339536 2010 Genome-wide association of lipid-lowering response to statins in combined study populations.
20133774 2010 The protein tyrosine phosphatases PTPRZ and PTPRG bind to distinct members of the contactin family of neural recognition molecules.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19509545 2009 Molecular genetic analysis of a cell adhesion molecule with homology to L1CAM, contactin 6, and contactin 4 candidate chromosome 3p26pter tumor suppressor genes in ovarian cancer.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14592966 2003 Nogo-A at CNS paranodes is a ligand of Caspr: possible regulation of K(+) channel localization.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9486763 1998 cDNA cloning and chromosomal localization of neural adhesion molecule NB-3 in human.
1838307 1991 Glycosylphosphatidylinositol anchored recognition molecules that function in axonal fasciculation, growth and guidance in the nervous system.