Property Summary

NCBI Gene PubMed Count 16
PubMed Score 273.03
PubTator Score 131.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
astrocytoma -1.900 4.6e-07
glioblastoma -4.000 1.9e-04
oligodendroglioma -2.100 9.5e-08
posterior fossa group A ependymoma -2.800 6.1e-07
group 4 medulloblastoma -4.800 1.7e-06
cystic fibrosis 3.523 8.9e-08
atypical teratoid / rhabdoid tumor -4.200 8.5e-07
medulloblastoma, large-cell -3.200 1.6e-03
primitive neuroectodermal tumor -3.100 5.3e-03
Atopic dermatitis -1.300 1.2e-02
interstitial cystitis -4.500 1.5e-06
adult high grade glioma -3.700 3.4e-05
pilocytic astrocytoma -2.200 4.3e-03
lung carcinoma 2.200 5.6e-17
Breast cancer -1.300 2.6e-02
gastric carcinoma -1.600 4.3e-02
invasive ductal carcinoma -1.500 2.1e-02
ulcerative colitis -3.400 6.3e-05
ovarian cancer -2.500 8.0e-04
chronic rhinosinusitis -1.916 3.4e-02

Gene RIF (4)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20360857 BIG1 and BIG2 have roles in endomembrane organization
19497516 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MMFPWKQLILLSFIGCLGGELLLQGPVFIKEPSNSIFPVGSEDKKITLHCEARGNPSPHYRWQLNGSDID      1 - 70
MSMEHRYKLNGGNLVVINPNRNWDTGTYQCFATNSLGTIVSREAKLQFAYLENFKTKMRSTVSVREGQGV     71 - 140
VLLCGPPPHSGELSYAWIFNEYPSFVEEDSRRFVSQETGHLYISKVEPSDVGNYTCVVTSMVTNARVLGS    141 - 210
PTPLVLRSDGVMGEYEPKIEVQFPETLPAAKGSTVKLECFALGNPIPQINWRRSDGLPFSSKIKLRKFSG    211 - 280
VLEIPNFQQEDAGSYECIAENSRGKNVARGRLTYYAKPHWVQLIKDVEIAVEDSLYWECRASGKPKPSYR    281 - 350
WLKNGAALVLEERTQIENGALTISNLSVTDSGMFQCIAENKHGLVYSSAELKVVASAPDFSKNPMKKLVQ    351 - 420
VQVGSLVSLDCKPRASPRALSSWKKGDVSVQEHERISLLNDGGLKIANVTKADAGTYTCMAENQFGKANG    421 - 490
TTHLVVTEPTRITLAPSNMDVSVGESVILPCQVQHDPLLDIIFTWYFNGALADFKKDGSHFEKVGGSSSG    491 - 560
DLMIRNIQLKHSGKYVCMVQTGVDSVSSAADLIVRGSPGPPENVKVDEITDTTAQLSWKEGKDNHSPVIS    561 - 630
YSIQARTPFSVGWQTVTTVPEVIDGKTHTATVVELNPWVEYEFRVVASNKIGGGEPSLPSEKVRTEEAVP    631 - 700
EVPPSEVNGGGGSRSELVITWDPVPEELQNGEGFGYVVAFRPLGVTTWIQTVVTSPDTPRYVFRNESIVP    701 - 770
YSPYEVKVGVYNNKGEGPFSPVTTVFSAEEEPTVAPSQVSANSLSSSEIEVSWNTIPWKLSNGHLLGYEV    771 - 840
RYWNGGGKEESSSKMKVAGNETSARLRGLKSNLAYYTAVRAYNSAGAGPFSATVNVTTKKTPPSQPPGNV    841 - 910
VWNATDTKVLLNWEQVKAMENESEVTGYKVFYRTSSQNNVQVLNTNKTSAELVLPIKEDYIIEVKATTDG    911 - 980
GDGTSSEQIRIPRITSMDARGSTSAISNVHPMSSYMPIVLFLIVYVLW                          981 - 1028
//

Text Mined References (19)

PMID Year Title
24665060 2014 Genome-wide association study of smoking behaviours among Bangladeshi adults.
22566634 2012 The genetic architecture of economic and political preferences.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20360857 2010 Specific functions of BIG1 and BIG2 in endomembrane organization.
20133774 2010 The protein tyrosine phosphatases PTPRZ and PTPRG bind to distinct members of the contactin family of neural recognition molecules.
19497516 2009 Identification of a genetic variant associated with abdominal aortic aneurysms on chromosome 3p12.3 by genome wide association.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18272596 2008 Interaction of amyloid precursor protein with contactins and NgCAM in the retinotectal system.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11013081 2000 Human NB-2 of the contactin subgroup molecules: chromosomal localization of the gene (CNTN5) and distinct expression pattern from other subgroup members.
10819331 2000 Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
8661054 1996 Plasmacytoma-associated neuronal glycoprotein, Pang, maps to mouse chromosome 6 and human chromosome 3.
8586965 1995 Overlapping and differential expression of BIG-2, BIG-1, TAG-1, and F3: four members of an axon-associated cell adhesion molecule subgroup of the immunoglobulin superfamily.
8108413 1994 PANG, a gene encoding a neuronal glycoprotein, is ectopically activated by intracisternal A-type particle long terminal repeats in murine plasmacytomas.