Property Summary

NCBI Gene PubMed Count 56
PubMed Score 80.57
PubTator Score 45.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
astrocytoma -1.100 3.0e-04
glioblastoma -4.100 3.3e-03
oligodendroglioma -1.200 5.6e-04
osteosarcoma 2.010 5.6e-06
sonic hedgehog group medulloblastoma -2.900 2.4e-03
atypical teratoid / rhabdoid tumor -5.800 5.0e-09
medulloblastoma, large-cell -2.700 1.6e-02
primitive neuroectodermal tumor -2.700 1.3e-02
Atopic dermatitis -1.700 3.0e-03
adrenocortical adenoma -1.156 3.2e-03
adrenocortical carcinoma -1.486 2.0e-04
intraductal papillary-mucinous adenoma (... -2.300 1.3e-03
intraductal papillary-mucinous neoplasm ... -2.200 2.6e-02
colon cancer -2.300 6.7e-05
lung cancer 2.000 2.6e-03
interstitial cystitis -2.200 2.9e-03
pediatric high grade glioma -2.900 9.6e-03
posterior fossa group A ependymoma 2.200 6.4e-08
subependymal giant cell astrocytoma -3.912 4.9e-03
Alzheimer's disease -1.400 3.9e-02
Pick disease -1.800 1.1e-03
progressive supranuclear palsy -1.200 3.6e-02
Breast cancer -1.300 2.1e-06
ovarian cancer -2.600 8.3e-09
pituitary cancer 2.200 2.5e-04

Protein-protein Interaction (5)

Gene RIF (20)

PMID Text
26795349 CNTN1 promotes prostate cancer progression.
26722434 CNTN1 is a new gene which can be regulated by RET/PTC3 (Ret proto-oncogene and Ret-activating protein ELE1) rearrangement gene and the protein level of CNTN1 is increasing in thyroid cancer.
26721881 Structurally, CASPR2 is highly glycosylated and has an overall compact architecture. CASPR2 associates with micromolar affinity with CNTN1 but, under the same conditions, it does not interact with any of the other members of the contactin family.
25960233 CNTN-1 is closely related with multidrug resistance of lung adenocarcinoma.
25952582 High CNTN-1 expression is associated with metastasis in gastric cancer.
25916117 under hypoxia conditions, elevated HIF-1alpha seems to up-regulate contactin-1 expression and by this activate RhoA and facilitate migration of cancer cells.
25808373 anti-CNTN1 IgG4 antibodies are associated with subacute onset of chronic inflammatory demyelinating polyneuropathy symptoms, sensory ataxia, and good response to corticosteroids.
23724143 activation of AKT plays a role in contactin-1-mediated downregulation of E-cadherin.
22581910 The expression of CNTN-1 is upregulated in esophageal squamous cell carcinoma tissue and is related to stage and lymphatic invasion. Thus, it may be involved in the pathogenesis & progression of esophageal squamous cell carcinoma.
22580838 A high expression of CNTN1 was markedly associated with the regional lymph node metastasis of patients with oral squamous cell carcinoma.
22360968 a completely novel function for F3/Contactin - modulator of neurogenesis
21969550 report the cocrystal structure of the carbonic anhydrase-like domain of PTPRZ bound to tandem Ig repeats of CNTN1 and binding assays to show that PTPRZ binds specifically to CNTN1 expressed at the surface of oligodendrocyte precursor cells
21805024 Data revealed that knockdown of VEGFR-3 with the shRNA lentiviral vector resulted in down-regulation of the downstream neural cell adhesion molecule contactin-1 (CNTN-1).
21482472 VEGF-C mediated biological function through transcription of CNTN-1, which is implicated in tumor invasion and metastasis.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
19026398 Mutations in CNTN1, a neural adhesion molecule and neuromuscular junction protein, cause a familial form of lethal congenital myopathy.
16510572 Contactin-1 is proposed to function importantly in the invasion and metastasis of lung adenocarcinoma cells via RhoA-mediated mechanisms.
16078236 The repulsive properties of contactin may be a key factor in glioma disaggregation, and may contribute to the diffuse infiltration pattern characteristic of glioma cells in human brain.
14567914 F3 acts as a functional ligand for Notch during oligodendrocyte maturation.

AA Sequence

MKMWLLVSHLVIISITTCLAEFTWYRRYGHGVSEEDKGFGPIFEEQPINTIYPEESLEGKVSLNCRARAS      1 - 70
PFPVYKWRMNNGDVDLTSDRYSMVGGNLVINNPDKQKDAGIYYCLASNNYGMVRSTEATLSFGYLDPFPP     71 - 140
EERPEVRVKEGKGMVLLCDPPYHFPDDLSYRWLLNEFPVFITMDKRRFVSQTNGNLYIANVEASDKGNYS    141 - 210
CFVSSPSITKSVFSKFIPLIPIPERTTKPYPADIVVQFKDVYALMGQNVTLECFALGNPVPDIRWRKVLE    211 - 280
PMPSTAEISTSGAVLKIFNIQLEDEGIYECEAENIRGKDKHQARIYVQAFPEWVEHINDTEVDIGSDLYW    281 - 350
PCVATGKPIPTIRWLKNGYAYHKGELRLYDVTFENAGMYQCIAENTYGAIYANAELKILALAPTFEMNPM    351 - 420
KKKILAAKGGRVIIECKPKAAPKPKFSWSKGTEWLVNSSRILIWEDGSLEINNITRNDGGIYTCFAENNR    421 - 490
GKANSTGTLVITDPTRIILAPINADITVGENATMQCAASFDPALDLTFVWSFNGYVIDFNKENIHYQRNF    491 - 560
MLDSNGELLIRNAQLKHAGRYTCTAQTIVDNSSASADLVVRGPPGPPGGLRIEDIRATSVALTWSRGSDN    561 - 630
HSPISKYTIQTKTILSDDWKDAKTDPPIIEGNMEAARAVDLIPWMEYEFRVVATNTLGRGEPSIPSNRIK    631 - 700
TDGAAPNVAPSDVGGGGGRNRELTITWAPLSREYHYGNNFGYIVAFKPFDGEEWKKVTVTNPDTGRYVHK    701 - 770
DETMSPSTAFQVKVKAFNNKGDGPYSLVAVINSAQDAPSEAPTEVGVKVLSSSEISVHWEHVLEKIVESY    771 - 840
QIRYWAAHDKEEAANRVQVTSQEYSARLENLLPDTQYFIEVGACNSAGCGPPSDMIEAFTKKAPPSQPPR    841 - 910
IISSVRSGSRYIITWDHVVALSNESTVTGYKVLYRPDGQHDGKLYSTHKHSIEVPIPRDGEYVVEVRAHS    911 - 980
DGGDGVVSQVKISGAPTLSPSLLGLLLPAFGILVYLEF                                    981 - 1018
//

Text Mined References (61)

PMID Year Title
26795349 2016 Neural Cell Adhesion Protein CNTN1 Promotes the Metastatic Progression of Prostate Cancer.
26722434 2015 Contactin 1 as a potential biomarker promotes cell proliferation and invasion in thyroid cancer.
26721881 2016 Structural Characterization of the Extracellular Domain of CASPR2 and Insights into Its Association with the Novel Ligand Contactin1.
25960233 2015 Increased sensitivity of human lung adenocarcinoma cells to cisplatin associated with downregulated contactin-1.
25952582 2015 Significances of contactin-1 expression in human gastric cancer and knockdown of contactin-1 expression inhibits invasion and metastasis of MKN45 gastric cancer cells.
25916117 [Under hypoxia condition contactin-1 regulates migration of MKN45 cells through RhoA pathway].
25808373 2015 Contactin 1 IgG4 associates to chronic inflammatory demyelinating polyneuropathy with sensory ataxia.
24986923 2014 A genome-wide association study identifies susceptibility loci of silica-related pneumoconiosis in Han Chinese.
24842889 2014 Genome-wide mapping of IBD segments in an Ashkenazi PD cohort identifies associated haplotypes.
23934736 2013 Genome-wide association study of a heart failure related metabolomic profile among African Americans in the Atherosclerosis Risk in Communities (ARIC) study.
23724143 2013 Contactin-1 reduces E-cadherin expression via activating AKT in lung cancer.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22925353 2013 A genome-wide association study of seasonal pattern mania identifies NF1A as a possible susceptibility gene for bipolar disorder.
22581910 2012 Contactin-1 (CNTN-1) overexpression is correlated with advanced clinical stage and lymph node metastasis in oesophageal squamous cell carcinomas.
22580838 2012 Contactin 1 (CNTN1) expression associates with regional lymph node metastasis and is a novel predictor of prognosis in patients with oral squamous cell carcinoma.
22360968 2012 F3/Contactin acts as a modulator of neurogenesis during cerebral cortex development.
21969550 2011 A complex between contactin-1 and the protein tyrosine phosphatase PTPRZ controls the development of oligodendrocyte precursor cells.
21805024 2011 Effect of lentivirus-mediated shRNA targeting VEGFR-3 on proliferation, apoptosis and invasion of gastric cancer cells.
21482472 2011 VEGF-C promotes the development of esophageal cancer via regulating CNTN-1 expression.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20133774 2010 The protein tyrosine phosphatases PTPRZ and PTPRG bind to distinct members of the contactin family of neural recognition molecules.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19026398 2008 Mutations in contactin-1, a neural adhesion and neuromuscular junction protein, cause a familial form of lethal congenital myopathy.
18464913 2008 A genome-wide association study identifies protein quantitative trait loci (pQTLs).
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16865674 2006 Diversity of contactin mRNA in human brain tumors.
16510572 2006 Knockdown of contactin-1 expression suppresses invasion and metastasis of lung adenocarcinoma.
16368877 2006 Genomic annotation of 15,809 ESTs identified from pooled early gestation human eyes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16078236 2006 Contactin is expressed in human astrocytic gliomas and mediates repulsive effects.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146195 2004 Time-controlled transcardiac perfusion cross-linking for the study of protein interactions in complex tissues.
14761957 2004 Sodium channel beta1 subunit-mediated modulation of Nav1.2 currents and cell surface density is dependent on interactions with contactin and ankyrin.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14676309 2003 Caspr regulates the processing of contactin and inhibits its binding to neurofascin.
14592966 2003 Nogo-A at CNS paranodes is a ligand of Caspr: possible regulation of K(+) channel localization.
14567914 2003 F3/contactin acts as a functional ligand for Notch during oligodendrocyte maturation.
12700241 2003 Phosphacan short isoform, a novel non-proteoglycan variant of phosphacan/receptor protein tyrosine phosphatase-beta, interacts with neuronal receptors and promotes neurite outgrowth.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12139915 2002 Analysis of interactions of the adhesion molecule TAG-1 and its domains with other immunoglobulin superfamily members.
11567041 2001 Contactin associates with Na+ channels and increases their functional expression.
11556889 2001 Mobilization of the cell adhesion glycoprotein F3/contactin to axonal surfaces is activity dependent.
10595523 1999 Ataxia and abnormal cerebellar microorganization in mice with ablated contactin gene expression.
10103110 1999 The interaction between F3 immunoglobulin domains and protein tyrosine phosphatases zeta/beta triggers bidirectional signalling between neurons and glial cells.
9651216 1998 Regulated expression of the cell adhesion glycoprotein F3 in adult hypothalamic magnocellular neurons.
9584610 1998 Multi-ligand interactions with receptor-like protein tyrosine phosphatase beta: implications for intercellular signaling.
9335257 1997 Signaling events following the interaction of the neuronal adhesion molecule F3 with the N-terminal domain of tenascin-R.
9081628 1996 Distinct effects of recombinant tenascin-R domains in neuronal cell functions and identification of the domain interacting with the neuronal recognition molecule F3/11.
9049255 1997 Induction of neurite outgrowth through contactin and Nr-CAM by extracellular regions of glial receptor tyrosine phosphatase beta.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8586965 1995 Overlapping and differential expression of BIG-2, BIG-1, TAG-1, and F3: four members of an axon-associated cell adhesion molecule subgroup of the immunoglobulin superfamily.
8164510 1994 Identification and characterization of the human cell adhesion molecule contactin.
7959734 1994 Molecular cloning and in situ localization of the human contactin gene (CNTN1) on chromosome 12q11-q12.
7628014 1995 The carbonic anhydrase domain of receptor tyrosine phosphatase beta is a functional ligand for the axonal cell recognition molecule contactin.
7595520 1995 The F3 neuronal glycosylphosphatidylinositol-linked molecule is localized to glycolipid-enriched membrane subdomains and interacts with L1 and fyn kinase in cerebellum.
2026173 1991 Isolation and characterization of a membrane glycoprotein from human brain with sequence similarities to cell adhesion proteins from chicken and mouse.
1838307 1991 Glycosylphosphatidylinositol anchored recognition molecules that function in axonal fasciculation, growth and guidance in the nervous system.