Property Summary

NCBI Gene PubMed Count 91
PubMed Score 991.25
PubTator Score 414.57

Knowledge Summary

Patent

No data available

Protein-protein Interaction (9)

Gene RIF (67)

PMID Text
26187860 CNTFR-specific mutants of CNTF have been developed that bind to the CNTFRalpha-LIFRbeta-gp130 receptor.
25833344 Human CNTF expression through lentiviral gene transfer in the rat striatum significantly decreased the levels of neuronal metabolites (N-acetyl-aspartate, N-acetyl-aspartyl-glutamate, and glutamate).
25118897 the biological effects of CNTF on retinoic acid (RA)-predifferentiated SH-SY5Y neuroblastoma cells and the underlying molecular mechanism of this effect were investigated for the first time
24802752 R28E mutation in CNTF abrogatesIL-6 receptor-dependent but retains CNTF receptor-dependent signaling via glycoprotein 130/ LIFR.
24191003 CNTF-mediated protection of photoreceptors requires initial activation of the cytokine receptor gp130 in Muller glial cells.
23948898 In this review, CNTF plays an important role in neurogenesis and differentiation of neural stem cells.
23944834 The levels of expression and secretion of BDNF and CTNF of induced cells were assessed using immunocytochemical, Real-Time polymerase chain reaction, and enzyme linked immunosorbent assay (ELISA).
23676962 Report favourable allelic patterns of ACTN3 and CNTF genes on aerobic performance in athletes.
23654315 CNTF elevated in umbilical cord blood from pre-eclamptic pregnancies
23653362 Data indicate that aspirin increased mRNA and protein expression of CNTF in primary mouse and human astrocytes in a dose- and time-dependent manner.
23194670 we show that the release of CNTF by glial cells is a very powerful stimulus for optic fiber regeneration and retinal ganglion cell survival after optic nerve crush
22337942 Ciliary neurotrophic factor levels were increased in painful PTT only.
21912637 CNTF's effects on retinal pigment epithelial (RPE) physiology
20952820 Peptide 6c, corresponding to human CNTF amino acid residues 147-150, induces neurogenesis, neuronal activity and proliferation of immature neurons in the dentate gyrus and improvement of spatial reference memory in mice.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20584990 Ciliary neurotrophic factor, and related (CNTF), ligands targeting the established CNTF receptor alpha, binds to sortilin with high affinity.
20428961 The role played by CNTF in retinal cell differentiation and survival in retinal progenitors, is reported.
20378664 Observational study of gene-disease association. (HuGE Navigator)
20219210 Data show that variants in CNTF were significantly associated with a lower age at onset of the eating disorders.
20219210 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19833146 In women the CNTF polymorphism (odds ratio (OR) = 2.15, 95%CI: 1.27-3.64, p = 0.004) are associated with weight gain.
19833146 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19751193 Studies indicate that leptin, CNTF, LIF and IL-6 present similar three-dimensional fold structure, interact with related class-I receptors and activate similar intracellular pathways.
19628720 The CNTF 1357 G --> A polymorphism explains only a small portion of the variability in the muscle strength response to training in women.
19628720 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19573019 Fusion of HIV-1 TAT to CNTF may have modified the CNTF capacity to induce intracellular signaling in hypothalamic neurons.
19525893 The results of this study provided further evidence that the production of ciliary neurotrophic factor by Schwann cells is markedly reduced in Charcot-Marie-Tooth type 1A neuropathy.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
19082510 Certain SNP patterns in VDR and CNTF genes showed better improvement of parameters associated with the effects of low-resistance training using exercise machines as analyzed by comparison between SNP patterns and factor analysis.
19008309 PTP-1B constitutes a key divergent element between leptin/insulin and CNTF signaling pathways at the neuronal level.
18728012 Ciliary neurotrophic factor, cardiotrophin-like cytokine, and neuropoietin share a conserved binding site on the ciliary neurotrophic factor receptor alpha chain
18669911 CNTF-mediated signaling is a molecular switch for neuronal versus glial differentiation of retinal stem cells/progenitors.
18603262 Observational study of gene-disease association. (HuGE Navigator)
18583979 Meta-analysis of gene-disease association. (HuGE Navigator)
18524890 In vivo and in vitro experiments implicate CNTF as an endogenous regulatory component of dopamine D2-receptor-dependent neurogenesis in the subventricular zone and the dentate gyrus of the hippocampus. (Review)
18303965 The relative treatment benefit of iloperidone compared with placebo in patients with schizophrenia is enhanced in patients homozygous G/G for the rs1800169 polymorphism of CNTF.
18303965 Clinical trial of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18293418 Continuous expression of striatal CNTF at the dose mediated by the expression cassette used in this study was detrimental to transgenic mice with Huntington's disease.
18282590 Observational study of gene-disease association. (HuGE Navigator)
18203754 Observational study of gene-disease association. (HuGE Navigator)
17651970 We conclude that absence of CNTF does not increase susceptibility for neurodegenerative disorders and confirm that it does not affect onset and course of familial and sporadic ALS.
17563726 Possible neuroprotective role of CNTF in the optic nerve head.
17272411 Observational study of gene-disease association. (HuGE Navigator)
17192435 CNTF negatively regulates phototransduction, which reduces the photoresponsiveness of rods, resulting in lower electroretinogram amplitudes following light stimulus.
16969278 Observational study of gene-disease association. (HuGE Navigator)
16797081 Observational study of gene-disease association. (HuGE Navigator)
16696750 Observational study of gene-disease association. (HuGE Navigator)
16210701 Observational study of gene-disease association. (HuGE Navigator)
16181490 Observational study of gene-disease association. (HuGE Navigator)
15843428 myogenic lineage-committed human myoblasts can dedifferentiate at a clonal level; CNTF is a novel regulator of skeletal myoblast dedifferentiation via p44/p42 MAPK pathway
15474906 Meta-analysis of gene-disease association. (HuGE Navigator)
15180291 In spite of axokine gene expression in retinal pigment epithelium, no photoreceptor rescue in retinal degeneration mice.
15047605 findings support the hypothesis that CNTF and leptin engage distinct CNS sites and CNTF possesses inflammatory properties distinct from leptin
14747836 Results do not support an effect of the CNTF null allele on body composition, contrary to previous findings.
14715713 Constitutive expression of cytokines in brain induces changes in gene expression characteristic of chronic inflammation leading to either temporal weight reduction (CNTF) or severe cachexia (leukemia inhibitory factor).
12890930 no evidence found to suggest that ciliary neurotrophic factor is involved in the pathogenesis of pelvic endometriosis
12643274 CTNF binds to the IL-6 receptor and has a role in neuroprotection
12470191 Observational study of gene-disease association. (HuGE Navigator)
12404108 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
11951178 Early onset of severe familial amyotrophic lateral sclerosis with a SOD-1 mutation: potential impact of CNTF as a candidate modifier gene.
11890844 Observational study of gene-disease association. (HuGE Navigator)
11890844 Association of a null mutation in the CNTF gene with early onset of multiple sclerosis.
11857064 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11857064 A null mutation in this protein was evaluated for a relationship to disease susceptibility and disease severity in patients with multiple sclerosis.
9236223 An interaction between apoE3 and CNTF occurs with both delipidated apeE3 and apoE3 found within a lipoprotein particle in cerebrospinal fluid. This interaction potentiates the survival-promoting activity of CNTF for hippocampal neurons.

AA Sequence

MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEA      1 - 70
ERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEAD     71 - 140
GMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM              141 - 200
//

Text Mined References (92)

PMID Year Title
26187860 2015 Ciliary neurotrophic factor (CNTF): New facets of an old molecule for treating neurodegenerative and metabolic syndrome pathologies.
25833344 2015 The neuroprotective agent CNTF decreases neuronal metabolites in the rat striatum: an in vivo multimodal magnetic resonance imaging study.
25416956 2014 A proteome-scale map of the human interactome network.
25118897 2014 Neuroprotective properties of ciliary neurotrophic factor on retinoic acid (RA)-predifferentiated SH-SY5Y neuroblastoma cells.
24802752 2014 The amino acid exchange R28E in ciliary neurotrophic factor (CNTF) abrogates interleukin-6 receptor-dependent but retains CNTF receptor-dependent signaling via glycoprotein 130 (gp130)/leukemia inhibitory factor receptor (LIFR).
24191003 2013 CNTF-mediated protection of photoreceptors requires initial activation of the cytokine receptor gp130 in Müller glial cells.
24129709 2013 Cross-talk between KLF4 and STAT3 regulates axon regeneration.
23948898 2013 Role of ciliary neurotrophic factor in the proliferation and differentiation of neural stem cells.
23944834 2013 Comparing brain-derived neurotrophic factor and ciliary neurotrophic factor secretion of induced neurotrophic factor secreting cells from human adipose and bone marrow-derived stem cells.
23676962 2013 Polymorphisms of alpha-actinin-3 and ciliary neurotrophic factor in national-level Italian athletes.
23654315 2013 Brain-derived neurotrophic factor and ciliary neurotrophic factor in maternal plasma and umbilical cord blood from pre-eclamptic and physiological pregnancies.
23653362 2013 Up-regulation of ciliary neurotrophic factor in astrocytes by aspirin: implications for remyelination in multiple sclerosis.
23194670 2013 Long-distance axonal regeneration induced by CNTF gene transfer is impaired by axonal misguidance in the injured adult optic nerve.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22337942 2012 Increased expression of IL-6 family members in tendon pathology.
21912637 2011 CNTF mediates neurotrophic factor secretion and fluid absorption in human retinal pigment epithelium.
20952820 2010 Beneficial effect of a CNTF tetrapeptide on adult hippocampal neurogenesis, neuronal plasticity, and spatial memory in mice.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20584990 2010 Sortilin facilitates signaling of ciliary neurotrophic factor and related helical type 1 cytokines targeting the gp130/leukemia inhibitory factor receptor beta heterodimer.
20428961 2010 Ciliary neurotrophic factor: a survival and differentiation inducer in human retinal progenitors.
20378664 2010 Analysis of multiple candidate genes in association with phenotypes of multiple sclerosis.
20219210 2010 Role of the neurotrophin network in eating disorders' subphenotypes: body mass index and age at onset of the disease.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19833146 2010 Sex-specific effects of CNTF, IL6 and UCP2 polymorphisms on weight gain.
19751193 2009 Leptin, ciliary neurotrophic factor, leukemia inhibitory factor and interleukin-6: class-I cytokines involved in the neuroendocrine regulation of the reproductive function.
19628720 2009 CNTF 1357 G -> A polymorphism and the muscle strength response to resistance training.
19573019 2009 Ciliary neurotrophic factor infused intracerebroventricularly shows reduced catabolic effects when linked to the TAT protein transduction domain.
19525893 2009 Impaired expression of ciliary neurotrophic factor in Charcot-Marie-Tooth type 1A neuropathy.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19082510 2009 Effects of vitamin D receptor gene polymorphisms on low-resistance training using exercise machines: the 'Power Rehabilitation' program.
19008309 2009 Leptin but not ciliary neurotrophic factor (CNTF) induces phosphotyrosine phosphatase-1B expression in human neuronal cells (SH-SY5Y): putative explanation of CNTF efficacy in leptin-resistant state.
18775332 2008 Structural organization of a full-length gp130/LIF-R cytokine receptor transmembrane complex.
18728012 2008 Ciliary neurotrophic factor, cardiotrophin-like cytokine, and neuropoietin share a conserved binding site on the ciliary neurotrophic factor receptor alpha chain.
18669911 2008 Ciliary neurotrophic factor-mediated signaling regulates neuronal versus glial differentiation of retinal stem cells/progenitors by concentration-dependent recruitment of mitogen-activated protein kinase and Janus kinase-signal transducer and activator of transcription pathways in conjunction with Notch signaling.
18603262 2009 Genetic risk factors and markers for Alzheimer's disease and/or depression in the VITA study.
18583979 2008 Systematic meta-analyses and field synopsis of genetic association studies in schizophrenia: the SzGene database.
18524890 2008 CNTF: a putative link between dopamine D2 receptors and neurogenesis.
18303965 2008 Effect of a ciliary neurotrophic factor polymorphism on schizophrenia symptom improvement in an iloperidone clinical trial.
18293418 2008 Sustained striatal ciliary neurotrophic factor expression negatively affects behavior and gene expression in normal and R6/1 mice.
18282590 2008 Leptin-adiposity relationship changes, plus behavioral and parental factors, are involved in the development of body weight in a Dutch children cohort.
18203754 2008 Association of NTRK3 and its interaction with NGF suggest an altered cross-regulation of the neurotrophin signaling pathway in eating disorders.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17651970 2007 Ciliary neurotrophic factor null alleles are not a risk factor for Charcot-Marie-Tooth disease, hereditary neuropathy with pressure palsies and amyotrophic lateral sclerosis.
17563726 2007 Expression of ciliary neurotrophic factor (CNTF) and its tripartite receptor complex by cells of the human optic nerve head.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17272411 2007 Polymorphisms in the CNTF and CNTF receptor genes are associated with muscle strength in men and women.
17192435 2006 Regulation of rod phototransduction machinery by ciliary neurotrophic factor.
16969278 2006 No association between the CNTF null mutation and schizophrenia or personality.
16797081 2006 Association study of BDNF and CNTF polymorphism to depression in non-demented subjects of the "VITA" study.
16696750 2006 Variation in the ciliary neurotrophic factor gene and muscle strength in older Caucasian women.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16210701 2005 Relation of weight maintenance and dietary restraint to peroxisome proliferator-activated receptor gamma2, glucocorticoid receptor, and ciliary neurotrophic factor polymorphisms.
16181490 2005 The relationship between ciliary neurotrophic factor (CNTF) genotype and motor unit physiology: preliminary studies.
16051226 2005 The N-terminal cytokine binding domain of LIFR is required for CNTF binding and signaling.
15843428 2005 Dedifferentiation of adult human myoblasts induced by ciliary neurotrophic factor in vitro.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15474906 2004 Meta-analyses of the association between genetic polymorphisms of neurotrophic factors and schizophrenia.
15180291 2003 Transgenic rd mice harboring axokine gene by Rpe65 gene promoter does not rescue photoreceptor degeneration.
15047605 2004 Ciliary neurotrophic factor and leptin induce distinct patterns of immediate early gene expression in the brain.
14747836 2004 Ciliary neurotrophic factor (CNTF) genotype and body composition.
14715713 2004 Differential modulation of energy balance by leptin, ciliary neurotrophic factor, and leukemia inhibitory factor gene delivery: microarray deoxyribonucleic acid-chip analysis of gene expression.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12890930 2003 Peritoneal fluid concentrations of ciliary neurotrophic factor, a gp130 cytokine, in women with endometriosis.
12643274 2003 Signaling of human ciliary neurotrophic factor (CNTF) revisited. The interleukin-6 receptor can serve as an alpha-receptor for CTNF.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12470191 2002 A null mutation in the CNTF gene is not associated with early onset of multiple sclerosis.
12404108 2002 Null mutation in human ciliary neurotrophic factor gene confers higher body mass index in males.
11951178 2002 Early onset of severe familial amyotrophic lateral sclerosis with a SOD-1 mutation: potential impact of CNTF as a candidate modifier gene.
11890844 2002 Association of a null mutation in the CNTF gene with early onset of multiple sclerosis.
11857064 2002 A null mutation within the ciliary neurotrophic factor (CNTF)-gene: implications for susceptibility and disease severity in patients with multiple sclerosis.
11849142 2002 Porcine BAC derived microsatellites linked to ADRBK1, CNTF and GAL on SSC2.
11464862 2001 Signaling pathway of ciliary neurotrophic factor in neuroblastoma cell lines.
10966616 2000 CLF associates with CLC to form a functional heteromeric ligand for the CNTF receptor complex.
10812968 2000 The ciliary neurotrophic factor and its receptor, CNTFR alpha.
10391209 1999 Characterization of single-nucleotide polymorphisms in coding regions of human genes.
9236223 1997 Apolipoprotein E binds to and potentiates the biological activity of ciliary neurotrophic factor.
8627290 1996 Binding interactions of leukemia inhibitory factor and ciliary neurotrophic factor with the different subunits of their high affinity receptors.
8449041 1993 Chromosomal localization of the human ciliary neurotrophic factor gene (CNTF) to 11q12 by fluorescence in situ hybridization.
8075647 1994 A null mutation in the human CNTF gene is not causally related to neurological diseases.
7852996 1994 Ciliary neurotrophic factor.
7810882 1994 Nonradioactive receptor binding assay for ciliary neurotrophic factor.
7796798 1995 Crystal structure of dimeric human ciliary neurotrophic factor determined by MAD phasing.
7753485 1995 cDNA cloning and chromosomal localization of the human ciliary neurotrophic factor gene.
7597043 1995 A role for ciliary neurotrophic factor as an inducer of reactive gliosis, the glial response to central nervous system injury.
2294592 1990 High-resolution mapping of human chromosome 11 by in situ hybridization with cosmid clones.
1915374 1991 Cloning and expression of human ciliary neurotrophic factor.
1883844 1991 Expression and characterization of recombinant human ciliary neurotrophic factor from Escherichia coli.
1861138 1991 Recombinant human and rat ciliary neurotrophic factors.
1840538 1991 Sequence and structural organization of the human gene encoding ciliary neurotrophic factor.
1714745 1991 Neuropoietic cytokines in the hematopoietic fold.
1281789 1992 Ciliary neurotrophic factor induces acute-phase protein expression in hepatocytes.