Property Summary

Ligand Count 1,912
NCBI Gene PubMed Count 184
PubMed Score 269.71
PubTator Score 829.99

Knowledge Summary

Patent (13,853)

Expression

  Differential Expression (4)

Disease log2 FC p
medulloblastoma, large-cell 1.300 1.7e-04
osteosarcoma 1.694 7.7e-05
ovarian cancer 1.200 1.3e-10
psoriasis 1.500 3.4e-03

 CSPA Cell Line (3)

Gene RIF (192)

AA Sequence

MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSY      1 - 70
LFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPS     71 - 140
YKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYG    141 - 210
HVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKA    211 - 280
FAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWP    281 - 350
DSRDLDLSDC                                                                351 - 360
//

Text Mined References (190)

PMID Year Title