Property Summary

NCBI Gene PubMed Count 416
PubMed Score 5235.65
PubTator Score 2005.16

Knowledge Summary

Patent (139,721)

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.9
Disease Target Count Z-score Confidence
Attention deficit hyperactivity disorder 272 0.0 0.7

Expression

  Differential Expression (25)

Disease log2 FC p
aldosterone-producing adenoma -1.558 4.7e-03
astrocytic glioma -1.700 1.8e-02
atypical teratoid / rhabdoid tumor -3.700 1.6e-04
Breast cancer -2.500 4.9e-02
colon cancer -3.100 2.3e-09
ductal carcinoma in situ -1.600 1.3e-03
ependymoma -2.800 1.2e-02
glioblastoma -1.800 2.1e-02
interstitial cystitis 1.200 1.4e-02
intraductal papillary-mucinous adenoma (... -1.400 2.8e-03
intraductal papillary-mucinous carcinoma... -1.500 2.9e-03
intraductal papillary-mucinous neoplasm ... -1.700 1.5e-02
invasive ductal carcinoma -1.800 3.0e-02
lung adenocarcinoma -1.100 3.2e-04
lung cancer -1.300 5.6e-04
medulloblastoma 1.100 4.4e-02
medulloblastoma, large-cell -2.800 1.3e-04
non-small cell lung cancer -1.405 2.7e-16
oligodendroglioma -1.500 3.1e-02
osteosarcoma 1.019 2.1e-05
ovarian cancer -2.400 1.4e-07
pituitary cancer -1.100 4.0e-07
psoriasis -1.100 1.1e-06
severe Alzheimer's disease -1.986 3.5e-02
tuberculosis -2.000 3.6e-05

Gene RIF (440)

AA Sequence

MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQL      1 - 70
VPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVLSLTLGTFTVLENLLVLCV     71 - 140
ILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVFHRKDSRNVFLFKLGGVTASFTASVGSLFLT    141 - 210
AIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWI    211 - 280
GVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILV    281 - 350
VLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQ    351 - 420
PLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL                      421 - 472
//

Text Mined References (421)

PMID Year Title