Property Summary

NCBI Gene PubMed Count 383
PubMed Score 5020.00
PubTator Score 2005.16

Knowledge Summary

Patent (139,721)

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
non-small cell lung cancer 2798 2.71616591829151E-16
posterior fossa group A ependymoma 1511 5.52484192896813E-12
colon cancer 1475 2.33177000884963E-9
oligodendroglioma 2849 1.14916283746481E-8
pituitary cancer 1972 8.08243156587694E-8
ovarian cancer 8492 1.40226116668355E-7
psoriasis 6685 1.09767601967863E-6
osteosarcoma 7933 2.06629274199658E-5
tuberculosis 1563 3.59986116711491E-5
medulloblastoma, large-cell 6234 1.33748748578921E-4
atypical teratoid / rhabdoid tumor 4369 1.61704727578863E-4
lung adenocarcinoma 2714 3.24580411454993E-4
lung cancer 4473 5.5971174585192E-4
ductal carcinoma in situ 1745 0.00130466269528994
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0028442507814546
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00291743714841089
aldosterone-producing adenoma 664 0.00470201135080584
interstitial cystitis 2299 0.0135223129426749
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0145884967931008
astrocytic glioma 2241 0.0183147405714309
glioblastoma 5572 0.0214900481178605
medulloblastoma 1524 0.0256273807267479
invasive ductal carcinoma 2950 0.0301497034003601
severe Alzheimer's disease 49 0.0346386192105658
Breast cancer 3099 0.0487494986185202

Expression

  Differential Expression (25)

Synonym

Accession P21554 B2R9T4 E1P512 Q13949 Q495Z0 Q4PLI4 Q4VBM6 Q5JVL5 Q5UB37 Q9UNN0 CB-R
Symbols CB1
CNR
CB-R
CB1A
CB1R
CANN6
CB1K5

Gene

PANTHER Protein Class (2)

PDB

1LVQ   1LVR   2B0Y   2KOE   2MZ2   2MZ3   2MZA  

  TechDev Info (1)

MLP Assay (10)

AID Type Active / Inconclusive / Inactive Description
686924 other 0 / 0 / 1 ML347 Eurofin Panel Assay for BMP Inhibitor (Probe Compound)
686925 other 0 / 0 / 1 ML352 Eurofin Panel Assay for Choline Transporter Inhibitor (Probe Compound)
686926 other 0 / 0 / 1 ML354 Eurofin Panel Assay for PAR4 Antagonists Inhibitor (Probe Compound)
686927 other 0 / 0 / 1 ML353 Eurofin Panel Assay for mGlu5 SAM Inhibitor (Probe Compound)
743249 screening 1 / 0 / 0 Development of the First Potent, Selective and CNS penetrant M5 Negative Allosteric Modulator (NAM)
743250 screening 1 / 0 / 0 Discovery and characterization of a small molecule allosteric agonists of mas-related G-Protein coupled receptor X1 ( MrgX1)
743251 screening 1 / 0 / 0 Development of a novel orthosteric Muscarinic 5 (M5) antagonist possessing a hig degree of muscarinic subtype selectivity
743252 screening 1 / 0 / 0 Development of the first CNS penetrant Muscarinic 5 (M5) Positive Allosteric Modulator based on a novel non-isatin core
743435 other 0 / 0 / 0 Development of inhibitors for Dopamine D4 Receptors: Eurofin Panel Assay Results
743437 other 0 / 0 / 0 Development of inhibitors for PLD2 (Eurofin Panel Assay Results)

Gene RIF (409)

PMID Text
26775260 Induction of apoptosis was mediated via CB1 as well as CB2, and expression of CB receptors was a prerequisite for therapy response in our models.
26717543 CNR1 polymorphism and child physical abuse GxE interaction predicts adult PTSD threat symptoms.
26634814 In the adult human ependyma, which usually shows central canal absence, CB1 may play a different role by modulating astrocyte functions
26527537 The cannabinoid 1 receptor polymorphism rs1049353, is involved in the processing of negative facial expressions with relation to anger in adolescence.
26467187 Human lung-resident macrophages express CB1 and CB2 receptors whose activation inhibits the release of angiogenic and lymphangiogenic factors
26343051 Studies indicate that crosstalk between cannabinoid receptor type 1 (CB1) and transient receptor potential vanilloid 1 (TRPV1) modulates pain and inflammation in arthritis.
26331953 The minor C allele of rs2023239 showed an independent protective effect against lifetime Manic Depressive Disorder.
26253623 data support an association between endocannabinoid system activity (cb1) and alcoholism.
26100912 Data indicate that Org 27569 affinity for cannabinoid receptor CB1 (CB1) Is different for CB1 mutants.
26071625 CNR1 variants are associated with structural and functional brain changes after first episode psychosis; the cannabinoid pathway is associated with disease progression over time.
More...

AA Sequence

MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQL      1 - 70
VPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVLSLTLGTFTVLENLLVLCV     71 - 140
ILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVFHRKDSRNVFLFKLGGVTASFTASVGSLFLT    141 - 210
AIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWI    211 - 280
GVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILV    281 - 350
VLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQ    351 - 420
PLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL                      421 - 472
//

Text Mined References (386)

PMID Year Title
26775260 2016 Dronabinol has preferential antileukemic activity in acute lymphoblastic and myeloid leukemia with lymphoid differentiation patterns.
26717543 2015 The rs1049353 polymorphism in the CNR1 gene interacts with childhood abuse to predict posttraumatic threat symptoms.
26634814 2015 CB1 cannabinoid receptor enrichment in the ependymal region of the adult human spinal cord.
26527537 2016 The role of the cannabinoid receptor in adolescents' processing of facial expressions.
26467187 2016 Human lung-resident macrophages express CB1 and CB2 receptors whose activation inhibits the release of angiogenic and lymphangiogenic factors.
26343051 2015 Cannabinoid-based drugs targeting CB1 and TRPV1, the sympathetic nervous system, and arthritis.
26331953 2015 A cannabinoid receptor 1 polymorphism is protective against major depressive disorder in methadone-maintained outpatients.
26253623 2015 Altered CB1 receptor coupling to G-proteins in the post-mortem caudate nucleus and cerebellum of alcoholic subjects.
26100912 2015 Structural dynamics and energetics underlying allosteric inactivation of the cannabinoid receptor CB1.
26071625 2015 Brain structural and clinical changes after first episode psychosis: Focus on cannabinoid receptor 1 polymorphisms.
More...