Property Summary

NCBI Gene PubMed Count 12
PubMed Score 10.62
PubTator Score 5.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (6)

Disease log2 FC p
inflammatory breast cancer 1.100 2.0e-04
lung adenocarcinoma 1.200 2.0e-04
lung cancer 1.400 1.6e-02
medulloblastoma, large-cell -1.100 1.5e-03
ovarian cancer 1.200 1.1e-03
psoriasis -1.800 4.1e-04

Gene RIF (7)

AA Sequence

MHSLATAAPVPTTLAQVDREKIYQWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEI      1 - 70
VNIYPSINPPTLTAHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSL     71 - 140
GVIGALVKTDEQEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYICQTYERFSHVA    141 - 210
MILGKMVLQLSKEPSARLLKHVVRCYLRLSDNPRAREALRQCLPDQLKDTTFAQVLKDDTTTKRWLAQLV    211 - 280
KNLQEGQVTDPRGIPLPPQ                                                       281 - 299
//

Text Mined References (21)

PMID Year Title