Property Summary

NCBI Gene PubMed Count 36
PubMed Score 667.95
PubTator Score 2175.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -1.626 7.0e-05
group 4 medulloblastoma 1.500 1.4e-03
medulloblastoma, large-cell 1.200 4.4e-06
tuberculosis and treatment for 6 months 1.200 1.9e-05
atypical teratoid/rhabdoid tumor 1.100 8.8e-04
aldosterone-producing adenoma -1.066 4.7e-02
lung adenocarcinoma 1.212 1.9e-06
pituitary cancer 1.100 1.7e-06

Gene RIF (14)

PMID Text
25944446 These results indicate that Caf1 and Ccr4 cooperate in mRNA deadenylation and suggest that the enzyme activities of Caf1 and Ccr4 are regulated via allosteric interactions within the nuclease module.
25038453 CNOT7/hCAF1 is involved in ICAM-1 and IL-8 regulation by TTP in HPMEC.
24115769 show that SMG7 binds directly to POP2, a catalytic subunit of the CCR4-NOT deadenylase complex, and elicits deadenylation-dependent decapping and 5'-to-3' decay of NMD targets
24036545 The loss of CAF-1 p48 subunit causes a strong defect in packaging DNA into nucleosomes.
23236473 The anti-proliferative activity of BTG/TOB proteins is mediated via the Caf1a (CNOT7) and Caf1b (CNOT8) deadenylase subunits of the Ccr4-not complex.
22977175 The NOT1 MIF4G domain binds CAF1 through a pre-formed interface and leaves the CAF1 catalytic site fully accessible to RNA substrates.
22683897 N-terminus played a role in modulating hCaf1 activity, stability and aggregation
21336257 Together, these results indicate that Tob mediates the recruitment of Caf1 to the target of CPEB3 and elicits deadenylation and decay of the mRNA.
20595394 Tob interactions with Caf1 and a C-terminal domain of PABPC1
20595389 MK2 phosphorylation reduces the ability of TTP to promote deadenylation by inhibiting the recruitment of CAF1 deadenylase in a mechanism that does not involve sequestration of TTP by 14-3-3.
20065043 CCR4-NOT is the deadenylase that removes poly(A) from messages destabilized by miRNAs in human cells.
19605561 Data show that efficient cell proliferation requires both CNOT7 and CNOT8, although combined knockdown of both subunits further reduces cell proliferation indicating partial redundancy between these proteins.
19558367 Data show that Ccr4-Not function in RNA splicing and nuclear export, and that CNOT8 binds CNOT6 in yeast two-hybrid assays.
17178784 Cellular POP2 protein binds to central adaptor protein ASC and pathogen recognition receptor PAN1, blocking formation of cryopyrin and PAN1-containing inflammasomes, activation of caspase-1, and subsequent processing of bioactive interleukin-1 beta.

AA Sequence

MPAALVENSQVICEVWASNLEEEMRKIREIVLSYSYIAMDTEFPGVVVRPIGEFRSSIDYQYQLLRCNVD      1 - 70
LLKIIQLGLTFTNEKGEYPSGINTWQFNFKFNLTEDMYSQDSIDLLANSGLQFQKHEEEGIDTLHFAELL     71 - 140
MTSGVVLCDNVKWLSFHSGYDFGYMVKLLTDSRLPEEEHEFFHILNLFFPSIYDVKYLMKSCKNLKGGLQ    141 - 210
EVADQLDLQRIGRQHQAGSDSLLTGMAFFRMKELFFEDSIDDAKYCGRLYGLGTGVAQKQNEDVDSAQEK    211 - 280
MSILAIINNMQQ                                                              281 - 292
//

Text Mined References (38)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25944446 2015 The enzyme activities of Caf1 and Ccr4 are both required for deadenylation by the human Ccr4-Not nuclease module.
25416956 2014 A proteome-scale map of the human interactome network.
25038453 2014 CNOT7/hCAF1 is involved in ICAM-1 and IL-8 regulation by tristetraprolin.
24115769 2013 The SMG5-SMG7 heterodimer directly recruits the CCR4-NOT deadenylase complex to mRNAs containing nonsense codons via interaction with POP2.
24036545 2013 Human CAF-1-dependent nucleosome assembly in a defined system.
23236473 2012 The anti-proliferative activity of BTG/TOB proteins is mediated via the Caf1a (CNOT7) and Caf1b (CNOT8) deadenylase subunits of the Ccr4-not complex.
22977175 2012 The structural basis for the interaction between the CAF1 nuclease and the NOT1 scaffold of the human CCR4-NOT deadenylase complex.
22683897 2012 The N-terminus modulates human Caf1 activity, structural stability and aggregation.
21900206 2011 A directed protein interaction network for investigating intracellular signal transduction.
21336257 2011 Anti-proliferative protein Tob negatively regulates CPEB3 target by recruiting Caf1 deadenylase.
21269460 2011 Initial characterization of the human central proteome.
20595394 2010 Quantitative characterization of Tob interactions provides the thermodynamic basis for translation termination-coupled deadenylase regulation.
20595389 2010 MAPKAP kinase 2 blocks tristetraprolin-directed mRNA decay by inhibiting CAF1 deadenylase recruitment.
20065043 2010 CCR4-NOT deadenylates mRNA associated with RNA-induced silencing complexes in human cells.
19605561 2009 The Ccr4-NOT deadenylase subunits CNOT7 and CNOT8 have overlapping roles and modulate cell proliferation.
19558367 2009 Human Ccr4-Not complexes contain variable deadenylase subunits.
17452450 2007 Depletion of mammalian CCR4b deadenylase triggers elevation of the p27Kip1 mRNA level and impairs cell growth.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17178784 2007 Cellular pyrin domain-only protein 2 is a candidate regulator of inflammasome activation.
16778766 2006 Human Ccr4-Not complex is a ligand-dependent repressor of nuclear receptor-mediated transcription.
16381901 2006 The LIFEdb database in 2006.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15769875 2005 Conservation of the deadenylase activity of proteins of the Caf1 family in human.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12771185 2003 BTG2 antiproliferative protein interacts with the human CCR4 complex existing in vivo in three cell-cycle-regulated forms.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11747467 2001 Identification of four families of yCCR4- and Mg2+-dependent endonuclease-related proteins in higher eukaryotes, and characterization of orthologs of yCCR4 with a conserved leucine-rich repeat essential for hCAF1/hPOP2 binding.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11136725 2001 Relationships of the antiproliferative proteins BTG1 and BTG2 with CAF1, the human homolog of a component of the yeast CCR4 transcriptional complex: involvement in estrogen receptor alpha signaling pathway.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10637334 2000 Isolation and characterization of human orthologs of yeast CCR4-NOT complex subunits.
10036195 1999 The human POP2 gene: identification, sequencing, and mapping to the critical region of the 5q- syndrome.
9820826 1998 Human carbon catabolite repressor protein (CCR4)-associative factor 1: cloning, expression and characterization of its interaction with the B-cell translocation protein BTG1.