Property Summary

NCBI Gene PubMed Count 26
PubMed Score 523.79
PubTator Score 13.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 1.100 1.8e-05
ependymoma 1.100 8.8e-03
osteosarcoma -3.925 3.8e-11
group 3 medulloblastoma -1.500 3.5e-05
atypical teratoid / rhabdoid tumor 1.400 1.2e-06
glioblastoma -1.200 3.3e-04
medulloblastoma, large-cell -1.700 1.1e-04
primitive neuroectodermal tumor 1.200 2.7e-04
lung cancer 1.600 1.4e-04
pediatric high grade glioma -1.100 2.1e-05

Gene RIF (9)

PMID Text
24121232 The CNOT2-CNOT3 heterodimer is stabilized and tightly anchored to the surface of CNOT1 through an unexpected intertwined arrangement of peptide regions lacking defined secondary structure.
24116917 A mutation in PRPF31 is hypostatic to a trait acting on CNOT3, with the RP11 phenotype only being observed when there is homozygous (recessive) inheritance of the higher expressivity CNOT3 ("symptomatic" or risk) allele.
23263491 CNOT3 is a tumor suppressor mutated in 7 of 89 (7.9%) adult T-cell acute lymphoblastic leukemias, and its knockdown causes tumors in a sensitized Drosophila melanogaster model.
23144630 In asymptomatic carriers CNOT3 is expressed at low levels, allowing higher amounts of wild-type PRPF31 transcripts to be produced and preventing manifestation of retinal degeneration.
22367759 Cnot1, Cnot2, and Cnot3 represent a novel component of the core self-renewal and pluripotency circuitry conserved in mouse and human ESCs.
22342980 CNOT3 depletion stabilizes the MAD1 mRNA, and MAD1 knockdown attenuates the CNOT3 depletion-induced increase of the mitotic index.
22294640 A high density SNP genotyping approach within the 19q13 chromosome region identifies an association of a CNOT3 polymorphism with ankylosing spondylitis.
20970119 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12207886 TBP-interacting protein 120B binds to NOT3

AA Sequence

MADKRKLQGEIDRCLKKVSEGVEQFEDIWQKLHNAANANQKEKYEADLKKEIKKLQRLRDQIKTWVASNE      1 - 70
IKDKRQLIDNRKLIETQMERFKVVERETKTKAYSKEGLGLAQKVDPAQKEKEEVGQWLTNTIDTLNMQVD     71 - 140
QFESEVESLSVQTRKKKGDKDKQDRIEGLKRHIEKHRYHVRMLETILRMLDNDSILVDAIRKIKDDVEYY    141 - 210
VDSSQDPDFEENEFLYDDLDLEDIPQALVATSPPSHSHMEDEIFNQSSSTPTSTTSSSPIPPSPANCTTE    211 - 280
NSEDDKKRGRSTDSEVSQSPAKNGSKPVHSNQHPQSPAVPPTYPSGPPPAASALSTTPGNNGVPAPAAPP    281 - 350
SALGPKASPAPSHNSGTPAPYAQAVAPPAPSGPSTTQPRPPSVQPSGGGGGGSGGGGSSSSSNSSAGGGA    351 - 420
GKQNGATSYSSVVADSPAEVALSSSGGNNASSQALGPPSGPHNPPPSTSKEPSAAAPTGAGGVAPGSGNN    421 - 490
SGGPSLLVPLPVNPPSSPTPSFSDAKAAGALLNGPPQFSTAPEIKAPEPLSSLKSMAERAAISSGIEDPV    491 - 560
PTLHLTERDIILSSTSAPPASAQPPLQLSEVNIPLSLGVCPLGPVPLTKEQLYQQAMEEAAWHHMPHPSD    561 - 630
SERIRQYLPRNPCPTPPYHHQMPPPHSDTVEFYQRLSTETLFFIFYYLEGTKAQYLAAKALKKQSWRFHT    631 - 700
KYMMWFQRHEEPKTITDEFEQGTYIYFDYEKWGQRKKEGFTFEYRYLEDRDLQ                     701 - 753
//

Text Mined References (34)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
24736845 2014 Structural basis for the Nanos-mediated recruitment of the CCR4-NOT complex and translational repression.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24121232 2013 Structure and assembly of the NOT module of the human CCR4-NOT complex.
24116917 2014 Dominant PRPF31 mutations are hypostatic to a recessive CNOT3 polymorphism in retinitis pigmentosa: a novel phenomenon of "linked trans-acting epistasis".
23263491 2013 Exome sequencing identifies mutation in CNOT3 and ribosomal genes RPL5 and RPL10 in T-cell acute lymphoblastic leukemia.
23144630 2012 CNOT3 is a modifier of PRPF31 mutations in retinitis pigmentosa with incomplete penetrance.
22367759 2012 Cnot1, Cnot2, and Cnot3 maintain mouse and human ESC identity and inhibit extraembryonic differentiation.
22342980 2012 Involvement of CNOT3 in mitotic progression through inhibition of MAD1 expression.
22294640 2012 A high density SNP genotyping approach within the 19q13 chromosome region identifies an association of a CNOT3 polymorphism with ankylosing spondylitis.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21299754 2011 CNOT2 depletion disrupts and inhibits the CCR4-NOT deadenylase complex and induces apoptotic cell death.
21269460 2011 Initial characterization of the human central proteome.
20970119 2011 Convergent animal and human evidence suggests a role of PPM1A gene in response to antidepressants.
19558367 2009 Human Ccr4-Not complexes contain variable deadenylase subunits.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18377426 2008 Interaction of antiproliferative protein Tob with the CCR4-NOT deadenylase complex.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17452450 2007 Depletion of mammalian CCR4b deadenylase triggers elevation of the p27Kip1 mRNA level and impairs cell growth.
16778766 2006 Human Ccr4-Not complex is a ligand-dependent repressor of nuclear receptor-mediated transcription.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15752756 2005 Identification of novel CBP interacting proteins in embryonic orofacial tissue.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14707134 2004 Repression of promoter activity by CNOT2, a subunit of the transcription regulatory Ccr4-not complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12207886 2002 TBP-interacting protein 120B, which is induced in relation to myogenesis, binds to NOT3.
10941842 2000 Extensive gene duplications and a large inversion characterize the human leukocyte receptor cluster.
10637334 2000 Isolation and characterization of human orthologs of yeast CCR4-NOT complex subunits.
9734811 1998 Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.