Property Summary

NCBI Gene PubMed Count 23
PubMed Score 600.84
PubTator Score 12.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Gene RIF (7)

PMID Text
24121232 The CNOT2-CNOT3 heterodimer is stabilized and tightly anchored to the surface of CNOT1 through an unexpected intertwined arrangement of peptide regions lacking defined secondary structure.
22367759 Cnot1, Cnot2, and Cnot3 represent a novel component of the core self-renewal and pluripotency circuitry conserved in mouse and human ESCs.
21299754 human CNOT2 is important for maintaining the deadenylase activity and structural integrity of the CCR4-NOT complex, thereby affecting cell viability.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16712523 This study shows that SMRT/NCoR-HDAC3 complex is a cofactor of CNOT2-mediated repression and suggests that transcriptional regulation by the Ccr4-Not complex involves regulation of chromatin modification.
16039607 These findings suggest that CDK11 may contribute to apoptosis by regulating the activity of NOT2 independent of its kinase activity.
14707134 major repression function of CNOT2 is localized in a specialized protein motif, the Not-Box

AA Sequence

MVRTDGHTLSEKRNYQVTNSMFGASRKKFVEGVDSDYHDENMYYSQSSMFPHRSEKDMLASPSTSGQLSQ      1 - 70
FGASLYGQQSALGLPMRGMSNNTPQLNRSLSQGTQLPSHVTPTTGVPTMSLHTPPSPSRGILPMNPRNMM     71 - 140
NHSQVGQGIGIPSRTNSMSSSGLGSPNRSSPSIICMPKQQPSRQPFTVNSMSGFGMNRNQAFGMNNSLSS    141 - 210
NIFNGTDGSENVTGLDLSDFPALADRNRREGSGNPTPLINPLAGRAPYVGMVTKPANEQSQDFSIHNEDF    211 - 280
PALPGSSYKDPTSSNDDSKSNLNTSGKTTSSTDGPKFPGDKSSTTQNNNQQKKGIQVLPDGRVTNIPQGM    281 - 350
VTDQFGMIGLLTFIRAAETDPGMVHLALGSDLTTLGLNLNSPENLYPKFASPWASSPCRPQDIDFHVPSE    351 - 420
YLTNIHIRDKLAAIKLGRYGEDLLFYLYYMNGGDVLQLLAAVELFNRDWRYHKEERVWITRAPGMEPTMK    421 - 490
TNTYERGTYYFFDCLNWRKVAKEFHLEYDKLEERPHLPSTFNYNPAQQAF                        491 - 540
//

Text Mined References (33)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24121232 2013 Structure and assembly of the NOT module of the human CCR4-NOT complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22959728 2013 Age of onset of amyotrophic lateral sclerosis is modulated by a locus on 1p34.1.
22367759 2012 Cnot1, Cnot2, and Cnot3 maintain mouse and human ESC identity and inhibit extraembryonic differentiation.
21981923 2011 GW182 proteins directly recruit cytoplasmic deadenylase complexes to miRNA targets.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21299754 2011 CNOT2 depletion disrupts and inhibits the CCR4-NOT deadenylase complex and induces apoptotic cell death.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19558367 2009 Human Ccr4-Not complexes contain variable deadenylase subunits.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18377426 2008 Interaction of antiproliferative protein Tob with the CCR4-NOT deadenylase complex.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17452450 2007 Depletion of mammalian CCR4b deadenylase triggers elevation of the p27Kip1 mRNA level and impairs cell growth.
16778766 2006 Human Ccr4-Not complex is a ligand-dependent repressor of nuclear receptor-mediated transcription.
16712523 2006 Involvement of the SMRT/NCoR-HDAC3 complex in transcriptional repression by the CNOT2 subunit of the human Ccr4-Not complex.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16039607 2005 The cyclin-dependent kinase 11 interacts with NOT2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14707134 2004 Repression of promoter activity by CNOT2, a subunit of the transcription regulatory Ccr4-not complex.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12882519 2003 The CCR4-NOT complex plays diverse roles in mRNA metabolism.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
10637334 2000 Isolation and characterization of human orthologs of yeast CCR4-NOT complex subunits.