Property Summary

NCBI Gene PubMed Count 9
PubMed Score 14.39
PubTator Score 114.58

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Gene RIF (2)

AA Sequence

MPGGGASAASGRLLTAAEQRGSREAAGSASRSGFGGSGGGRGGASGPGSGSGGPGGPAGRMSLTPKELSS      1 - 70
LLSIISEEAGGGSTFEGLSTAFHHYFSKADHFRLGSVLVMLLQQPDLLPSAAQRLTALYLLWEMYRTEPL     71 - 140
AANPFAASFAHLLNPAPPARGGQEPDRPPLSGFLPPITPPEKFFLSQLMLAPPRELFKKTPRQIALMDVG    141 - 210
NMGQSVDISGLQLALAERQSELPTQSKASFPSILSDPDPDSSNSGFDSSVASQITEALVSGPKPPIESHF    211 - 280
RPEFIRPPPPLHICEDELAWLNPTEPDHAIQWDKSMCVKNSTGVEIKRIMAKAFKSPLSSPQQTQLLGEL    281 - 350
EKDPKLVYHIGLTPAKLPDLVENNPLVAIEMLLKLMQSSQITEYFSVLVNMDMSLHSMEVVNRLTTAVDL    351 - 420
PPEFIHLYISNCISTCEQIKDKYMQNRLVRLVCVFLQSLIRNKIINVQDLFIEVQAFCIEFSRIREAAGL    421 - 490
FRLLKTLDTGETPSETKMSK                                                      491 - 510
//

Text Mined References (11)

PMID Year Title