Property Summary

NCBI Gene PubMed Count 42
PubMed Score 114.98
PubTator Score 31.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
ovarian cancer 8491 8.2e-10
atypical teratoid / rhabdoid tumor 4369 9.9e-07
medulloblastoma 1524 5.1e-06
osteosarcoma 7933 6.5e-06
medulloblastoma, large-cell 6234 2.6e-05
psoriasis 6685 9.2e-05
ependymoma 2514 1.7e-02
spina bifida 1064 4.4e-02
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Heart conduction disease 65 0.0 1.0
Disease Target Count Z-score Confidence
Myocardial stunning 8 3.323 1.7

Expression

  Differential Expression (8)

Disease log2 FC p
ependymoma 1.100 1.7e-02
psoriasis -1.600 9.2e-05
osteosarcoma -1.170 6.5e-06
atypical teratoid / rhabdoid tumor 1.400 9.9e-07
medulloblastoma 1.200 5.1e-06
medulloblastoma, large-cell 1.700 2.6e-05
spina bifida -1.246 4.4e-02
ovarian cancer -1.700 8.2e-10

Protein-protein Interaction (9)

Gene RIF (13)

PMID Text
25663449 Single nucleotide polymorphism in CNOT1 gene is associated with osteosarcoma susceptibility.
25035296 CNOT1 facilitates recruitment of DDX6 to miRNA-targeted mRNAs, placing DDX6 as a downstream effector in the miRNA silencing pathway.
24768540 Crystal structure of the DDX6, CNOT9 and CNOT1 complex.
24768538 Crystal structures of the DDX6, CNOT1 and CNOT9 complexes.
24433985 SNP rs7188697 A/G significantly associated with response to dendritic cells therapeutic HIV vaccine
24121232 The CNOT2-CNOT3 heterodimer is stabilized and tightly anchored to the surface of CNOT1 through an unexpected intertwined arrangement of peptide regions lacking defined secondary structure.
23644599 Authors identify an evolutionarily conserved C-terminal motif in human TTP that directly binds a central domain of CNOT1, a core subunit of the CCR4-NOT complex.
22977175 The NOT1 MIF4G domain binds CAF1 through a pre-formed interface and leaves the CAF1 catalytic site fully accessible to RNA substrates.
22367759 Cnot1, Cnot2, and Cnot3 represent a novel component of the core self-renewal and pluripotency circuitry conserved in mouse and human ESCs.
21976065 Depletion of CNOT1 induces cell death in a caspase-dependent manner.
19558367 Data show that Ccr4-Not function in RNA splicing and nuclear export, and that CNOT1 binds CNOT4 in yeast two-hybrid assays.
16778766 CNOT1 interacts in a ligand-dependent manner with RXR and represses transcription mediated by several RXR heterodimers.
11733989 purification and characterization of 1.0 MDa yeast CCR4-NOT complex identifies two novel components, CAF40 and CAF130: yeast CAF40 binds human NOT1

AA Sequence

MNLDSLSLALSQISYLVDNLTKKNYRASQQEIQHIVNRHGPEADRHLLRCLFSHVDFSGDGKSSGKDFHQ      1 - 70
TQFLIQECALLITKPNFISTLSYAIDNPLHYQKSLKPAPHLFAQLSKVLKLSKVQEVIFGLALLNSSSSD     71 - 140
LRGFAAQFIKQKLPDLLRSYIDADVSGNQEGGFQDIAIEVLHLLLSHLLFGQKGAFGVGQEQIDAFLKTL    141 - 210
RRDFPQERCPVVLAPLLYPEKRDILMDRILPDSGGVAKTMMESSLADFMQEVGYGFCASIEECRNIIVQF    211 - 280
GVREVTAAQVARVLGMMARTHSGLTDGIPLQSISAPGSGIWSDGKDKSDGAQAHTWNVEVLIDVLKELNP    281 - 350
SLNFKEVTYELDHPGFQIRDSKGLHNVVYGIQRGLGMEVFPVDLIYRPWKHAEGQLSFIQHSLINPEIFC    351 - 420
FADYPCHTVATDILKAPPEDDNREIATWKSLDLIESLLRLAEVGQYEQVKQLFSFPIKHCPDMLVLALLQ    421 - 490
INTSWHTLRHELISTLMPIFLGNHPNSAIILHYAWHGQGQSPSIRQLIMHAMAEWYMRGEQYDQAKLSRI    491 - 560
LDVAQDLKALSMLLNGTPFAFVIDLAALASRREYLKLDKWLTDKIREHGEPFIQACMTFLKRRCPSILGG    561 - 630
LAPEKDQPKSAQLPPETLATMLACLQACAGSVSQELSETILTMVANCSNVMNKARQPPPGVMPKGRPPSA    631 - 700
SSLDAISPVQIDPLAGMTSLSIGGSAAPHTQSMQGFPPNLGSAFSTPQSPAKAFPPLSTPNQTTAFSGIG    701 - 770
GLSSQLPVGGLGTGSLTGIGTGALGLPAVNNDPFVQRKLGTSGLNQPTFQQSKMKPSDLSQVWPEANQHF    771 - 840
SKEIDDEANSYFQRIYNHPPHPTMSVDEVLEMLQRFKDSTIKREREVFNCMLRNLFEEYRFFPQYPDKEL    841 - 910
HITACLFGGIIEKGLVTYMALGLALRYVLEALRKPFGSKMYYFGIAALDRFKNRLKDYPQYCQHLASISH    911 - 980
FMQFPHHLQEYIEYGQQSRDPPVKMQGSITTPGSIALAQAQAQAQVPAKAPLAGQVSTMVTTSTTTTVAK    981 - 1050
TVTVTRPTGVSFKKDVPPSINTTNIDTLLVATDQTERIVEPPENIQEKIAFIFNNLSQSNMTQKVEELKE   1051 - 1120
TVKEEFMPWVSQYLVMKRVSIEPNFHSLYSNFLDTLKNPEFNKMVLNETYRNIKVLLTSDKAAANFSDRS   1121 - 1190
LLKNLGHWLGMITLAKNKPILHTDLDVKSLLLEAYVKGQQELLYVVPFVAKVLESSIRSVVFRPPNPWTM   1191 - 1260
AIMNVLAELHQEHDLKLNLKFEIEVLCKNLALDINELKPGNLLKDKDRLKNLDEQLSAPKKDVKQPEELP   1261 - 1330
PITTTTTSTTPATNTTCTATVPPQPQYSYHDINVYSLAGLAPHITLNPTIPLFQAHPQLKQCVRQAIERA   1331 - 1400
VQELVHPVVDRSIKIAMTTCEQIVRKDFALDSEESRMRIAAHHMMRNLTAGMAMITCREPLLMSISTNLK   1401 - 1470
NSFASALRTASPQQREMMDQAAAQLAQDNCELACCFIQKTAVEKAGPEMDKRLATEFELRKHARQEGRRY   1471 - 1540
CDPVVLTYQAERMPEQIRLKVGGVDPKQLAVYEEFARNVPGFLPTNDLSQPTGFLAQPMKQAWATDDVAQ   1541 - 1610
IYDKCITELEQHLHAIPPTLAMNPQAQALRSLLEVVVLSRNSRDAIAALGLLQKAVEGLLDATSGADADL   1611 - 1680
LLRYRECHLLVLKALQDGRAYGSPWCNKQITRCLIECRDEYKYNVEAVELLIRNHLVNMQQYDLHLAQSM   1681 - 1750
ENGLNYMAVAFAMQLVKILLVDERSVAHVTEADLFHTIETLMRINAHSRGNAPEGLPQLMEVVRSNYEAM   1751 - 1820
IDRAHGGPNFMMHSGISQASEYDDPPGLREKAEYLLREWVNLYHSAAAGRDSTKAFSAFVGQMHQQGILK   1821 - 1890
TDDLITRFFRLCTEMCVEISYRAQAEQQHNPAANPTMIRAKCYHNLDAFVRLIALLVKHSGEATNTVTKI   1891 - 1960
NLLNKVLGIVVGVLLQDHDVRQSEFQQLPYHRIFIMLLLELNAPEHVLETINFQTLTAFCNTFHILRPTK   1961 - 2030
APGFVYAWLELISHRIFIARMLAHTPQQKGWPMYAQLLIDLFKYLAPFLRNVELTKPMQILYKGTLRVLL   2031 - 2100
VLLHDFPEFLCDYHYGFCDVIPPNCIQLRNLILSAFPRNMRLPDPFTPNLKVDMLSEINIAPRILTNFTG   2101 - 2170
VMPPQFKKDLDSYLKTRSPVTFLSDLRSNLQVSNEPGNRYNLQLINALVLYVGTQAIAHIHNKGSTPSMS   2171 - 2240
TITHSAHMDIFQNLAVDLDTEGRYLFLNAIANQLRYPNSHTHYFSCTMLYLFAEANTEAIQEQITRVLLE   2241 - 2310
RLIVNRPHPWGLLITFIELIKNPAFKFWNHEFVHCAPEIEKLFQSVAQCCMGQKQAQQVMEGTGAS       2311 - 2376
//

Text Mined References (50)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25663449 2015 Polymorphisms in miRNA processing genes and their role in osteosarcoma risk.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
25038453 2014 CNOT7/hCAF1 is involved in ICAM-1 and IL-8 regulation by tristetraprolin.
25035296 2014 Human DDX6 effects miRNA-mediated gene silencing via direct binding to CNOT1.
24952745 2014 Genetic association study of QT interval highlights role for calcium signaling pathways in myocardial repolarization.
24768540 2014 A DDX6-CNOT1 complex and W-binding pockets in CNOT9 reveal direct links between miRNA target recognition and silencing.
24768538 2014 Structural and biochemical insights to the role of the CCR4-NOT complex and DDX6 ATPase in microRNA repression.
24736845 2014 Structural basis for the Nanos-mediated recruitment of the CCR4-NOT complex and translational repression.
24433985 2014 Exome analysis of HIV patients submitted to dendritic cells therapeutic vaccine reveals an association of CNOT1 gene with response to the treatment.
24121232 2013 Structure and assembly of the NOT module of the human CCR4-NOT complex.
23644599 2013 Structural basis for the recruitment of the human CCR4-NOT deadenylase complex by tristetraprolin.
23463101 2013 GW182 proteins cause PABP dissociation from silenced miRNA targets in the absence of deadenylation.
23232451 2013 C2ORF29/CNOT11 and CNOT10 form a new module of the CCR4-NOT complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23172285 2013 The interactions of GW182 proteins with PABP and deadenylases are required for both translational repression and degradation of miRNA targets.
22977175 2012 The structural basis for the interaction between the CAF1 nuclease and the NOT1 scaffold of the human CCR4-NOT deadenylase complex.
22726844 2012 A common variant in SLC8A1 is associated with the duration of the electrocardiographic QT interval.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22367759 2012 Cnot1, Cnot2, and Cnot3 maintain mouse and human ESC identity and inhibit extraembryonic differentiation.
21984185 2011 miRNA-mediated deadenylation is orchestrated by GW182 through two conserved motifs that interact with CCR4-NOT.
21981923 2011 GW182 proteins directly recruit cytoplasmic deadenylase complexes to miRNA targets.
21976065 2011 The role of the CNOT1 subunit of the CCR4-NOT complex in mRNA deadenylation and cell viability.
21525035 2011 PEX14 is required for microtubule-based peroxisome motility in human cells.
21278420 2011 Not1 mediates recruitment of the deadenylase Caf1 to mRNAs targeted for degradation by tristetraprolin.
21269460 2011 Initial characterization of the human central proteome.
20062063 2010 Several common variants modulate heart rate, PR interval and QRS duration.
19946888 2010 Defining the membrane proteome of NK cells.
19558367 2009 Human Ccr4-Not complexes contain variable deadenylase subunits.
19305409 2009 Common variants at ten loci modulate the QT interval duration in the QTSCD Study.
19305408 2009 Common variants at ten loci influence QT interval duration in the QTGEN Study.
18377426 2008 Interaction of antiproliferative protein Tob with the CCR4-NOT deadenylase complex.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17452450 2007 Depletion of mammalian CCR4b deadenylase triggers elevation of the p27Kip1 mRNA level and impairs cell growth.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16778766 2006 Human Ccr4-Not complex is a ligand-dependent repressor of nuclear receptor-mediated transcription.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
11972353 2002 A two-step strategy for constructing specifically self-subtracted cDNA libraries.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.
10637334 2000 Isolation and characterization of human orthologs of yeast CCR4-NOT complex subunits.
10231032 1999 Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.