Property Summary

NCBI Gene PubMed Count 32
PubMed Score 15.31
PubTator Score 19.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -1.576 4.2e-04
atypical teratoid / rhabdoid tumor 1.200 2.3e-04
medulloblastoma, large-cell 1.200 4.9e-05
tuberculosis and treatment for 6 months 1.500 9.0e-06
ulcerative colitis -3.100 1.0e-09
group 3 medulloblastoma -1.200 1.6e-03
lung carcinoma 1.300 3.5e-22

 MGI Phenotype (1)

Pathway (1)

Gene RIF (12)

PMID Text
25184538 The T568I mutation causes the magnesium transporter, CNNM2, to become 'locked' in its flat form.
25053769 meta-analysis of two Caucasian cohorts did not show an association between five aneurysm associated loci and sporadic brain Arteriovenous malformations.
24699222 Cells expressing mutated CNNM2 proteins did not show increased Mg(2+) uptake.
24311551 This CNNM2 risk variant rs7914558 may have an impact on neural systems relevant to social cognition.
24160291 Our findings suggest that the genetic variant in the CNNM2 gene could be implicated in the pathogenesis of schizophrenia through the gray matter volumetric vulnerability of the orbital regions in the inferior frontal gyri.
23027747 crystals of CNNM2 belonged to space groups P2(1)2(1)2 and I222 (or I2(1)2(1)2(1)) and diffracted X-rays to 2.0 and 3.6 A resolution, respectively, using synchrotron radiation
22399287 analysis of structure of CNNM2 and its post-translational modifications
21397062 The CNNM2 locus is associated with serum Mg(2+) concentrations.
20519162 ACDP2 splice-variant 1 is a functional Mg2+-transporting entity per se.
20479155 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MIGCGACEPKVKMAGGQAAAALPTWKMAARRSLSARGRGILQAAAGRLLPLLLLSCCCGAGGCAAVGENE      1 - 70
ETVIIGLRLEDTNDVSFMEGGALRVSERTRVKLRVYGQNINNETWSRIAFTEHERRRHSPGERGLGGPAP     71 - 140
PEPDSGPQRCGIRTSDIIILPHIILNRRTSGIIEIEIKPLRKMEKSKSYYLCTSLSTPALGAGGSGSTGG    141 - 210
AVGGKGGSGVAGLPPPPWAETTWIYHDGEDTKMIVGEEKKFLLPFWLQVIFISLLLCLSGMFSGLNLGLM    211 - 280
ALDPMELRIVQNCGTEKEKNYAKRIEPVRRQGNYLLCSLLLGNVLVNTTLTILLDDIAGSGLVAVVVSTI    281 - 350
GIVIFGEIVPQAICSRHGLAVGANTIFLTKFFMMMTFPASYPVSKLLDCVLGQEIGTVYNREKLLEMLRV    351 - 420
TDPYNDLVKEELNIIQGALELRTKTVEDVMTPLRDCFMITGEAILDFNTMSEIMESGYTRIPVFEGERSN    421 - 490
IVDLLFVKDLAFVDPDDCTPLKTITKFYNHPLHFVFNDTKLDAMLEEFKKGKSHLAIVQRVNNEGEGDPF    491 - 560
YEVLGIVTLEDVIEEIIKSEILDETDLYTDNRTKKKVAHRERKQDFSAFKQTDSEMKVKISPQLLLAMHR    561 - 630
FLATEVEAFSPSQMSEKILLRLLKHPNVIQELKYDEKNKKAPEYYLYQRNKPVDYFVLILQGKVEVEAGK    631 - 700
EGMKFEASAFSYYGVMALTASPVPLSLSRTFVVSRTELLAAGSPGENKSPPRPCGLNHSDSLSRSDRIDA    701 - 770
VTPTLGSSNNQLNSSLLQVYIPDYSVRALSDLQFVKISRQQYQNALMASRMDKTPQSSDSENTKIELTLT    771 - 840
ELHDGLPDETANLLNEQNCVTHSKANHSLHNEGAI                                       841 - 875
//

Text Mined References (35)

PMID Year Title
25184538 2014 Nucleotide binding triggers a conformational change of the CBS module of the magnesium transporter CNNM2 from a twisted towards a flat structure.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
25053769 2015 Evaluation of genetic risk loci for intracranial aneurysms in sporadic arteriovenous malformations of the brain.
24699222 2014 CNNM2 mutations cause impaired brain development and seizures in patients with hypomagnesemia.
24311551 2014 Effects of a novel schizophrenia risk variant rs7914558 at CNNM2 on brain structure and attributional style.
24262325 2014 Shared genetic susceptibility to ischemic stroke and coronary artery disease: a genome-wide analysis of common variants.
24160291 2013 The impact of the genome-wide supported variant in the cyclin M2 gene on gray matter morphology in schizophrenia.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23894747 2013 A comprehensive family-based replication study of schizophrenia genes.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23453885 2013 Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23027747 2012 Purification, crystallization and preliminary crystallographic analysis of the CBS-domain pair of cyclin M2 (CNNM2).
22688191 2012 Genome-wide association study in a Swedish population yields support for greater CNV and MHC involvement in schizophrenia compared with bipolar disorder.
22399287 2012 Membrane topology and intracellular processing of cyclin M2 (CNNM2).
22383894 2012 Genome-wide association study identifies chromosome 10q24.32 variants associated with arsenic metabolism and toxicity phenotypes in Bangladesh.
21926974 2011 Genome-wide association study identifies five new schizophrenia loci.
21572416 2011 Meta-analysis of genome-wide association studies identifies common variants associated with blood pressure variation in east Asians.
21397062 2011 CNNM2, encoding a basolateral protein required for renal Mg2+ handling, is mutated in dominant hypomagnesemia.
21393841 2011 Purification, crystallization and preliminary crystallographic analysis of the CBS pair of the human metal transporter CNNM4.
21378990 2011 Large-scale association analysis identifies 13 new susceptibility loci for coronary artery disease.
21378988 2011 A genome-wide association study in Europeans and South Asians identifies five new loci for coronary artery disease.
20519162 2010 Splice-variant 1 of the ancient domain protein 2 (ACDP2) complements the magnesium-deficient growth phenotype of Salmonella enterica sv. typhimurium strain MM281.
20479155 2010 Blood pressure and hypertension are associated with 7 loci in the Japanese population.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20364137 2010 Genome-wide association study of intracranial aneurysm identifies three new risk loci.
19915575 2009 Genome-wide association study reveals genetic risk underlying Parkinson's disease.
19430483 2009 Genome-wide association study identifies eight loci associated with blood pressure.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12657465 2003 Molecular cloning and characterization of a novel gene family of four ancient conserved domain proteins (ACDP).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.