Property Summary

NCBI Gene PubMed Count 9
PubMed Score 5.36
PubTator Score 3.48

Knowledge Summary


No data available


  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 3.200 2.5e-08
astrocytic glioma -1.200 3.5e-03
ependymoma -2.100 5.3e-19
glioblastoma -2.100 1.4e-10
oligodendroglioma -1.100 3.1e-13
group 3 medulloblastoma -2.600 3.6e-06
atypical teratoid/rhabdoid tumor -2.300 4.1e-12
primitive neuroectodermal tumor -2.200 2.9e-06
pediatric high grade glioma -2.200 6.3e-10
pilocytic astrocytoma -1.600 1.6e-06

Gene RIF (2)

20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

SDFEENVGKKLLRTLSGQKRKRSPEGERTSEDNSNLTPLIT                                 911 - 951

Text Mined References (13)

PMID Year Title
22412388 2012 A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci.
21393841 2011 Purification, crystallization and preliminary crystallographic analysis of the CBS pair of the human metal transporter CNNM4.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14723793 2004 Molecular cloning and characterization of the mouse Acdp gene family.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12707951 2003 High resolution mapping and mutation analyses of candidate genes in the urofacial syndrome (UFS) critical region.
12657465 2003 Molecular cloning and characterization of a novel gene family of four ancient conserved domain proteins (ACDP).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.