Property Summary

NCBI Gene PubMed Count 25
PubMed Score 14.90
PubTator Score 12.57

Knowledge Summary

Patent

No data available

Expression

Gene RIF (9)

AA Sequence

MTHFNKGPSYGLSAEVKNKIASKYDHQAEEDLRNWIEEVTGMSIGPNFQLGLKDGIILCELINKLQPGSV      1 - 70
KKVNESSLNWPQLENIGNFIKAIQAYGMKPHDIFEANDLFENGNMTQVQTTLVALAGLAKTKGFHTTIDI     71 - 140
GVKYAEKQTRRFDEGKLKAGQSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTDKPFDQTTISLQMGT    141 - 210
NKGASQAGMLAPGTRRDIYDQKLTLQPVDNSTISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPV    211 - 280
IHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYQDDYPRDYQYSDQGIDY                         281 - 329
//

Text Mined References (30)

PMID Year Title