Property Summary

NCBI Gene PubMed Count 24
PubMed Score 13.54
PubTator Score 12.57

Knowledge Summary

Patent

No data available

Expression

Gene RIF (8)

PMID Text
26175098 overexpressed CNN3 during sonic vibration increases expression of glutamate receptors and promotes functional neural differentiation of human umbilical cords-mesenchymal stem cells.
25050546 CNN3 as a new pro-invasive protein in trophoblast cells that is induced under low oxygen conditions.
23545751 Participates in actin stress fiber remodeling
22119193 The mRNA and protein level of calponin-3 were increase expression in brain in patiens with epilepsy.
20861310 Results indicate that CNN3 regulates actin cytoskeleton rearrangement which is required for the plasma membranes of trophoblasts to become fusion competent.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18927281 Gene rearrangements of CNN3 is associated with mucosa-associated lymphoid tissue lymphoma.
17825283 These results suggest a role of calponin 3 in the regulation of Bone morphogenetic proteins -dependent cellular responses.

AA Sequence

MTHFNKGPSYGLSAEVKNKIASKYDHQAEEDLRNWIEEVTGMSIGPNFQLGLKDGIILCELINKLQPGSV      1 - 70
KKVNESSLNWPQLENIGNFIKAIQAYGMKPHDIFEANDLFENGNMTQVQTTLVALAGLAKTKGFHTTIDI     71 - 140
GVKYAEKQTRRFDEGKLKAGQSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTDKPFDQTTISLQMGT    141 - 210
NKGASQAGMLAPGTRRDIYDQKLTLQPVDNSTISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPV    211 - 280
IHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYQDDYPRDYQYSDQGIDY                         281 - 329
//

Text Mined References (29)

PMID Year Title
26175098 2015 Overexpressed Calponin3 by Subsonic Vibration Induces Neural Differentiation of hUC-MSCs by Regulating the Ionotropic Glutamate Receptor.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25050546 2014 CNN3 regulates trophoblast invasion and is upregulated by hypoxia in BeWo cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23545751 2013 Calponin 3 regulates stress fiber formation in dermal fibroblasts during wound healing.
23362303 2013 Genome-wide association study identifies novel loci associated with concentrations of four plasma phospholipid fatty acids in the de novo lipogenesis pathway: results from the Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) consortium.
22119193 2012 Increased expression of calponin-3 in epileptic patients and experimental rats.
21492153 2011 Analysis of proteomic changes induced upon cellular differentiation of the human intestinal cell line Caco-2.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20861310 2010 Calponin 3 regulates actin cytoskeleton rearrangement in trophoblastic cell fusion.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18927281 2008 Mucosa-associated lymphoid tissue lymphoma: novel translocations including rearrangements of ODZ2, JMJD2C, and CNN3.
17825283 2007 Identification of calponin 3 as a novel Smad-binding modulator of BMP signaling expressed in cartilage.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15206927 2004 Tyrosine phosphorylation of calponins. Inhibition of the interaction with F-actin.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12033495 2002 Functional analysis of rat acidic calponin.
11591653 2001 Protein-protein interaction panel using mouse full-length cDNAs.
10457177 1999 Acidic calponin immunoreactivity in postnatal rat brain and cultures: subcellular localization in growth cones, under the plasma membrane and along actin and glial filaments.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8526917 1995 Molecular cloning and gene mapping of human basic and acidic calponins.