Property Summary

NCBI Gene PubMed Count 19
PubMed Score 107.75
PubTator Score 57.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (2)

Disease log2 FC p
lung carcinoma 4.000 4.5e-49
psoriasis -1.100 6.2e-03

Gene RIF (11)

PMID Text
26165347 Data suggest ChM1 as potential tumor suppressor in gastric cancer and useful biomarker for the treatment and prognosis. Its expression was downregulated in cancer tissue, and correlated with advanced stages, lymph node metastasis, and poorer prognosis.
24710035 intact 20-25 kDa ChM-I is stored as a component of extracellular matrix in the avascular cartilage zones, but it is inactivated by a single N-terminal proteolytic cleavage in the hypertrophic zone of growth-plate cartilage
23143879 the inner meniscus contained larger amounts of ChM-I, and that the inner meniscus-derived ChM-I inhibited endothelial cell proliferation.
22041680 Degenerative intervertebral disc cells express ChM-I. Administration of bFGF down-regulates the expression of ChM-I. Expression is correlated with the degree of degeneration.
20663886 Inhibition of YY1 in combination with forced expression of p300 and Sp3 restored the expression of ChM-I in cells with a hypomethylated promoter region, but not in cells with hypermethylation.
20026108 Data suggest that chondromodulin-I impairs the VEGF-A-stimulated motility of endothelial cells by destabilizing lamellipodial extensions.
18077449 new hypoxia-inducible and SOX9-regulated genes, Gdf10 and Chm-I. In addition, Mig6 and InhbA were induced by hypoxia, predominantly via HIF-2alpha
17980151 Cell-specific epigenetic regulation of ChM-I gene expression
16980969 chondromodulin-I has a pivotal role in maintaining valvular normal function by preventing angiogenesis that may lead to valvular heart diseases
16142856 Observational study of gene-disease association. (HuGE Navigator)
15107420 Methylation in the core-promoter region of the chondromodulin-I gene determines the cell-specific expression by regulating the binding of transcriptional activator Sp3

AA Sequence

MTENSDKVPIALVGPDDVEFCSPPAYATLTVKPSSPARLLKVGAVVLISGAVLLLFGAIGAFYFWKGSDS      1 - 70
HIYNVHYTMSINGKLQDGSMEIDAGNNLETFKMGSGAEEAIAVNDFQNGITGIRFAGGEKCYIKAQVKAR     71 - 140
IPEVGAVTKQSISSKLEGKIMPVKYEENSLIWVAVDQPVKDNSFLSSKVLELCGDLPIFWLKPTYPKEIQ    141 - 210
RERREVVRKIVPTTTKRPHSGPRSNPGAGRLNNETRPSVQEDSQAFNPDNPYHQQEGESMTFDPRLDHEG    211 - 280
ICCIECRRSYTHCQKICEPLGGYYPWPYNYQGCRSACRVIMPCSWWVARILGMV                    281 - 334
//

Text Mined References (21)

PMID Year Title
26165347 2015 Chondromodulin-1 functions as a tumor suppressor in gastric adenocarcinoma.
24710035 2014 The N-terminal cleavage of chondromodulin-I in growth-plate cartilage at the hypertrophic and calcified zones during bone development.
23143879 2013 Chondromodulin-I derived from the inner meniscus prevents endothelial cell proliferation.
22041680 2011 [Expression of chondromodulin-1 in the adult degenerative intervertebral disc].
20663886 2010 Histone modifiers, YY1 and p300, regulate the expression of cartilage-specific gene, chondromodulin-I, in mesenchymal stem cells.
20026108 2010 Impairment of VEGF-A-stimulated lamellipodial extensions and motility of vascular endothelial cells by chondromodulin-I, a cartilage-derived angiogenesis inhibitor.
18077449 2008 Hypoxia promotes the differentiated human articular chondrocyte phenotype through SOX9-dependent and -independent pathways.
17980151 2008 Cell-specific epigenetic regulation of ChM-I gene expression: crosstalk between DNA methylation and histone acetylation.
16980969 2006 Chondromodulin-I maintains cardiac valvular function by preventing angiogenesis.
16142856 2005 Association of chondromodulin-II Val58Ile polymorphism with radiographic joint destruction in rheumatoid arthritis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15107420 2004 Methylation in the core-promoter region of the chondromodulin-I gene determines the cell-specific expression by regulating the binding of transcriptional activator Sp3.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14744535 2004 Expression of the chondromodulin-I gene in chondrosarcomas.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11323410 2001 Post-translational processing of bovine chondromodulin-I.
10912526 2000 Chondromodulin-I as a novel cartilage-specific growth-modulating factor.
10750556 2000 Genomic organization of the human chondromodulin-1 gene containing a promoter region that confers the expression of reporter gene in chondrogenic ATDC5 cells.
10570955 1999 Specific loss of chondromodulin-I gene expression in chondrosarcoma and the suppression of tumor angiogenesis and growth by its recombinant protein in vivo.
10103018 1999 Molecular cloning of human chondromodulin-I, a cartilage-derived growth modulating factor, and its expression in Chinese hamster ovary cells.
9731231 1998 Expression of cartilage-specific functional matrix chondromodulin-I mRNA in rabbit growth plate chondrocytes and its responsiveness to growth stimuli in vitro.