Property Summary

NCBI Gene PubMed Count 27
PubMed Score 15.22
PubTator Score 22.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Intellectual disability 1016 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 3.5e-05
psoriasis 6694 2.2e-04
malignant mesothelioma 3232 4.4e-04
invasive ductal carcinoma 2951 1.9e-02
spina bifida 1074 2.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Multiple Sclerosis 540 0.0 1.4

Expression

  Differential Expression (5)

Disease log2 FC p
invasive ductal carcinoma 1.100 1.9e-02
malignant mesothelioma 1.200 4.4e-04
osteosarcoma -1.260 3.5e-05
psoriasis -1.200 2.2e-04
spina bifida -1.279 2.4e-02

Protein-protein Interaction (9)

Gene RIF (13)

AA Sequence

MEPVETWTPGKVATWLRGLDDSLQDYPFEDWQLPGKNLLQLCPQSLEALAVRSLGHQELILGGVEQLQAL      1 - 70
SSRLQTENLQSLTEGLLGATHDFQSIVQGCLGDCAKTPIDVLCAAVELLHEADALLFWLSRYLFSHLNDF     71 - 140
SACQEIRDLLEELSQVLHEDGPAAEKEGTVLRICSHVAGICHNILVCCPKELLEQKAVLEQVQLDSPLGL    141 - 210
EIHTTSNCQHFVSQVDTQVPTDSRLQIQPGDEVVQINEQVVVREERDMVGWPRKNMVRELLREPAGLSLV    211 - 280
LKKIPIPETPPQTPPQVLDSPHQRSPSLSLAPLSPRAPSEDVFAFDLSSNPSPGPSPAWTDSASLGPEPL    281 - 350
PIPPEPPAILPAGVAGTPGLPESPDKSPVGRKKSKGLATRLSRRRVSCRELGRPDCDGWLLLRKAPGGFM    351 - 420
GPRWRRRWFVLKGHTLYWYRQPQDEKAEGLINVSNYSLESGHDQKKKYVFQLTHDVYKPFIFAADTLTDL    421 - 490
SMWVRHLITCISKYQSPGRAPPPREEDCYSETEAEDPDDEAGSHSASPSPAQAGSPLHGDTSPAATPTQR    491 - 560
SPRTSFGSLTDSSEEALEGMVRGLRQGGVSLLGQPQPLTQEQWRSSFMRRNRDPQLNERVHRVRALQSTL    561 - 630
KAKLQELQVLEEVLGDPELTGEKFRQWKEQNRELYSEGLGAWGVAQAEGSSHILTSDSTEQSPHSLPSDP    631 - 700
EEHSHLCPLTSESSLRPPDL                                                      701 - 720
//

Text Mined References (31)

PMID Year Title