Property Summary

NCBI Gene PubMed Count 26
PubMed Score 13.13
PubTator Score 22.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Intellectual disability 573
Disease Target Count P-value
osteosarcoma 7933 3.5e-05
psoriasis 6685 2.2e-04
malignant mesothelioma 3163 4.4e-04
invasive ductal carcinoma 2950 1.9e-02
spina bifida 1064 2.4e-02
Disease Target Count Z-score Confidence
Multiple Sclerosis 498 0.0 1.0

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.200 4.4e-04
psoriasis -1.200 2.2e-04
osteosarcoma -1.260 3.5e-05
spina bifida -1.279 2.4e-02
invasive ductal carcinoma 1.100 1.9e-02

Protein-protein Interaction (9)

Gene RIF (12)

PMID Text
26319181 tyrosine phosphorylation is an important mechanism to control the subcellular localization of CNK1 and its distinct biological functions.
24825906 CNK1 mediates ephrinB1 signaling that promotes cell migration through RhoA and JNK activity.
21320536 Studies indicate that CNK1-driven proliferation relies on Akt-dependent phosphorylation and inactivation of FoxO proteins.
20634316 These findings identify CNK1 as a new positive regulator of insulin signaling.
20383191 CNK1 promotes oncogenic signalling through Akt in breast cancer cell lines and tumours.
20197385 Thus, CNK1 is an essential mediator of an oncogenic pathway involved in invasion of breast and cervical cancer cells and is therefore a putative target for cancer therapy.
19718030 DC-SIGN was constitutively associated with a signalosome complex consisting of the scaffold proteins LSP1, KSR1 and CNK and the kinase Raf-1.
16289034 CNK1 binds through the sterile alpha motif (SAM) and the conserved region in CNK (CRIC) to the AT2 receptor. CNK1 may play a role in the AT2 receptor-mediated signaling pathways.
15845549 CNK1 allows cross-talk between Src and Raf-1 and is essential for the full activation of Raf-1
15753034 CNK1 couples a subset of Rho exchange factors to activation of the JNK MAP kinase pathway and that signaling specificity is achieved through complexes containing both upstream activators and downstream targets of Rho.
15075335 Data show that the connector enhancer of KSR 1 scaffold protein, through its binding of a RASSF1A/MST1 complex, participates in the proapoptotic signaling initiated by active Ras.
14749388 hCNK1 associates with Rhophilin and RalGDS, Rho and Ras effector molecules, respectively, suggesting that it acts as a scaffold protein to mediate cross talk between the two pathways

AA Sequence

MEPVETWTPGKVATWLRGLDDSLQDYPFEDWQLPGKNLLQLCPQSLEALAVRSLGHQELILGGVEQLQAL      1 - 70
SSRLQTENLQSLTEGLLGATHDFQSIVQGCLGDCAKTPIDVLCAAVELLHEADALLFWLSRYLFSHLNDF     71 - 140
SACQEIRDLLEELSQVLHEDGPAAEKEGTVLRICSHVAGICHNILVCCPKELLEQKAVLEQVQLDSPLGL    141 - 210
EIHTTSNCQHFVSQVDTQVPTDSRLQIQPGDEVVQINEQVVVREERDMVGWPRKNMVRELLREPAGLSLV    211 - 280
LKKIPIPETPPQTPPQVLDSPHQRSPSLSLAPLSPRAPSEDVFAFDLSSNPSPGPSPAWTDSASLGPEPL    281 - 350
PIPPEPPAILPAGVAGTPGLPESPDKSPVGRKKSKGLATRLSRRRVSCRELGRPDCDGWLLLRKAPGGFM    351 - 420
GPRWRRRWFVLKGHTLYWYRQPQDEKAEGLINVSNYSLESGHDQKKKYVFQLTHDVYKPFIFAADTLTDL    421 - 490
SMWVRHLITCISKYQSPGRAPPPREEDCYSETEAEDPDDEAGSHSASPSPAQAGSPLHGDTSPAATPTQR    491 - 560
SPRTSFGSLTDSSEEALEGMVRGLRQGGVSLLGQPQPLTQEQWRSSFMRRNRDPQLNERVHRVRALQSTL    561 - 630
KAKLQELQVLEEVLGDPELTGEKFRQWKEQNRELYSEGLGAWGVAQAEGSSHILTSDSTEQSPHSLPSDP    631 - 700
EEHSHLCPLTSESSLRPPDL                                                      701 - 720
//

Text Mined References (30)

PMID Year Title
26319181 2015 Differential tyrosine phosphorylation controls the function of CNK1 as a molecular switch in signal transduction.
25416956 2014 A proteome-scale map of the human interactome network.
24825906 2014 EphrinB1 interacts with CNK1 and promotes cell migration through c-Jun N-terminal kinase (JNK) activation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21320536 2011 CNK1 and other scaffolds for Akt/FoxO signaling.
20634316 2010 The CNK1 scaffold binds cytohesins and promotes insulin pathway signaling.
20383191 2010 CNK1 is a novel Akt interaction partner that promotes cell proliferation through the Akt-FoxO signalling axis.
20197385 2010 CNK1 promotes invasion of cancer cells through NF-kappaB-dependent signaling.
19718030 2009 Carbohydrate-specific signaling through the DC-SIGN signalosome tailors immunity to Mycobacterium tuberculosis, HIV-1 and Helicobacter pylori.
18821524 2008 Systemic analysis of TGFbeta proteomics revealed involvement of Plag1/CNK1/RASSF1A/Src network in TGFbeta1-dependent activation of Erk1/2 and cell proliferation.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18287031 2008 CNK and HYP form a discrete dimer by their SAM domains to mediate RAF kinase signaling.
17496912 2007 KSR and CNK: two scaffolds regulating RAS-mediated RAF activation.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16289034 2005 The scaffold protein CNK1 interacts with the angiotensin II type 2 receptor.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15845549 2005 CNK1 is a scaffold protein that regulates Src-mediated Raf-1 activation.
15753034 2005 Association of CNK1 with Rho guanine nucleotide exchange factors controls signaling specificity downstream of Rho.
15670823 2005 Bioluminescence resonance energy transfer identify scaffold protein CNK1 interactions in intact cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15075335 2004 The scaffold protein CNK1 interacts with the tumor suppressor RASSF1A and augments RASSF1A-induced cell death.
14749388 2004 Human CNK1 acts as a scaffold protein, linking Rho and Ras signal transduction pathways.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10557308 1999 Functional analysis of CNK in RAS signaling.
9814705 1998 CNK, a RAF-binding multidomain protein required for RAS signaling.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.