Property Summary

NCBI Gene PubMed Count 14
PubMed Score 1.05
PubTator Score 0.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
hepatocellular carcinoma 1.100 6.9e-06
Waldenstrons macroglobulinemia 1.020 4.5e-02
Multiple myeloma 1.481 2.9e-03
astrocytoma 1.100 2.4e-12
glioblastoma 2.300 1.8e-04
oligodendroglioma 1.200 4.6e-10
posterior fossa group A ependymoma 1.500 8.0e-07
group 3 medulloblastoma 2.100 8.2e-04
atypical teratoid/rhabdoid tumor 1.700 9.4e-07
medulloblastoma, large-cell 1.600 8.8e-05
primitive neuroectodermal tumor 1.300 1.0e-02
primary pancreatic ductal adenocarcinoma 1.858 8.2e-04
intraductal papillary-mucinous neoplasm ... 1.300 1.2e-02
lung cancer 1.300 2.1e-03
pancreatic cancer 1.600 2.5e-03
Breast cancer 2.700 2.8e-02
pediatric high grade glioma 1.900 4.2e-06
breast carcinoma 1.100 2.8e-22
invasive ductal carcinoma 1.100 4.1e-02
ulcerative colitis -1.300 6.1e-08
ovarian cancer 2.500 3.0e-04
dermatomyositis 1.600 2.8e-03

AA Sequence

MEAVVFVFSLLDCCALIFLSVYFIITLSDLECDYINARSCCSKLNKWVIPELIGHTIVTVLLLMSLHWFI      1 - 70
FLLNLPVATWNIYRYIMVPSGNMGVFDPTEIHNRGQLKSHMKEAMIKLGFHLLCFFMYLYSMILALIND      71 - 139
//

Text Mined References (15)

PMID Year Title
24405750 2014 CNIH4 interacts with newly synthesized GPCR and controls their export from the endoplasmic reticulum.
21269460 2011 Initial characterization of the human central proteome.
21042317 2012 Genome-wide association study of major depressive disorder: new results, meta-analysis, and lessons learned.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.