Property Summary

NCBI Gene PubMed Count 7
PubMed Score 9.22
PubTator Score 6.01

Knowledge Summary

Patent (1,278)

TINX Plot

  Disease (2)

Disease Target Count P-value
posterior fossa group B ependymoma 416 1.5e-06
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (1)

Disease log2 FC p
posterior fossa group B ependymoma 1.800 1.5e-06

AA Sequence

MSQDTKVKTTESSPPAPSKARKLLPVLDPSGDYYYWWLNTMVFPVMYNLIILVCRACFPDLQHGYLVAWL      1 - 70
VLDYTSDLLYLLDMVVRFHTGFLEQGILVVDKGRISSRYVRTWSFFLDLASLMPTDVVYVRLGPHTPTLR     71 - 140
LNRFLRAPRLFEAFDRTETRTAYPNAFRIAKLMLYIFVVIHWNSCLYFALSRYLGFGRDAWVYPDPAQPG    141 - 210
FERLRRQYLYSFYFSTLILTTVGDTPPPAREEEYLFMVGDFLLAVMGFATIMGSMSSVIYNMNTADAAFY    211 - 280
PDHALVKKYMKLQHVNRKLERRVIDWYQHLQINKKMTNEVAILQHLPERLRAEVAVSVHLSTLSRVQIFQ    281 - 350
NCEASLLEELVLKLQPQTYSPGEYVCRKGDIGQEMYIIREGQLAVVADDGITQYAVLGAGLYFGEISIIN    351 - 420
IKGNMSGNRRTANIKSLGYSDLFCLSKEDLREVLSEYPQAQTIMEEKGREILLKMNKLDVNAEAAEIALQ    421 - 490
EATESRLRGLDQQLDDLQTKFARLLAELESSALKIAYRIERLEWQTREWPMPEDLAEADDEGEPEEGTSK    491 - 560
DEEGRASQEGPPGPE                                                           561 - 575
//

Text Mined References (11)

PMID Year Title