Property Summary

Ligand Count 4
NCBI Gene PubMed Count 22
PubMed Score 69.83
PubTator Score 39.40

Knowledge Summary

Patent (1,400)

Expression

  Differential Expression (7)

Disease log2 FC p
active Crohn's disease -1.075 6.4e-03
cutaneous lupus erythematosus -2.000 3.5e-04
interstitial cystitis -1.700 6.6e-03
pituitary cancer 2.300 3.2e-05
psoriasis -1.500 2.6e-03
spina bifida -1.974 3.9e-02
ulcerative colitis -1.400 4.1e-06

Protein-protein Interaction (1)

Gene RIF (10)

AA Sequence

MKLSMKNNIINTQQSFVTMPNVIVPDIEKEIRRMENGACSSFSEDDDSASTSEESENENPHARGSFSYKS      1 - 70
LRKGGPSQREQYLPGAIALFNVNNSSNKDQEPEEKKKKKKEKKSKSDDKNENKNDPEKKKKKKDKEKKKK     71 - 140
EEKSKDKKEEEKKEVVVIDPSGNTYYNWLFCITLPVMYNWTMVIARACFDELQSDYLEYWLILDYVSDIV    141 - 210
YLIDMFVRTRTGYLEQGLLVKEELKLINKYKSNLQFKLDVLSLIPTDLLYFKLGWNYPEIRLNRLLRFSR    211 - 280
MFEFFQRTETRTNYPNIFRISNLVMYIVIIIHWNACVFYSISKAIGFGNDTWVYPDINDPEFGRLARKYV    281 - 350
YSLYWSTLTLTTIGETPPPVRDSEYVFVVVDFLIGVLIFATIVGNIGSMISNMNAARAEFQARIDAIKQY    351 - 420
MHFRNVSKDMEKRVIKWFDYLWTNKKTVDEKEVLKYLPDKLRAEIAINVHLDTLKKVRIFADCEAGLLVE    421 - 490
LVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKAGNR    491 - 560
RTANIKSIGYSDLFCLSKDDLMEALTEYPDAKTMLEEKGKQILMKDGLLDLNIANAGSDPKDLEEKVTRM    561 - 630
EGSVDLLQTRFARILAEYESMQQKLKQRLTKVEKFLKPLIDTEFSSIEGPGAESGPIDST              631 - 690
//

Text Mined References (23)

PMID Year Title