Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.76
PubTator Score 2.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 7.5e-93
non-small cell lung cancer 2798 6.4e-11
nasopharyngeal carcinoma 1056 3.0e-04
lung cancer 4473 2.2e-02
spina bifida 1064 4.2e-02
Disease Target Count Z-score Confidence
Alopecia 55 3.259 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
non-small cell lung cancer 1.984 6.4e-11
lung cancer -3.200 2.2e-02
psoriasis 3.000 7.5e-93
nasopharyngeal carcinoma -2.400 3.0e-04
spina bifida -2.221 4.2e-02

Synonym

Accession Q9BYD5 B2R569
Symbols PLAC8L2

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MSYPVTSQPQCATTSCYQTQLSDWHTGLTDCCNDMPVCLCGTFAPLCLACRISDDFGECCCAPYLPGGLH      1 - 70
SIRTGMRERYHIQGSVGHDWAALTFCLPCALCQMARELKIRE                                 71 - 112
//

Text Mined References (6)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15147942 2004 Identification and characterization of a novel component of the cornified envelope, cornifelin.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9115270 1997 S100A11, S100A10, annexin I, desmosomal proteins, small proline-rich proteins, plasminogen activator inhibitor-2, and involucrin are components of the cornified envelope of cultured human epidermal keratinocytes.