Property Summary

NCBI Gene PubMed Count 20
PubMed Score 235.38
PubTator Score 230.45

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.004 1.3e-02
osteosarcoma 1.370 7.5e-04
astrocytoma 1.100 3.2e-02
juvenile dermatomyositis 1.080 1.5e-11
tuberculosis 1.200 3.2e-04
ovarian cancer 2.000 1.4e-03

 GWAS Trait (1)

Protein-protein Interaction (3)

Gene RIF (10)

PMID Text
25964343 To identify substrates of orphan transporter ATP-binding cassette subfamily C member 5 (ABCC5), identified a class of metabolites, N-lactoyl-amino acids, and found that a protease, cytosolic nonspecific dipeptidase 2 (CNDP2), catalyzes their formation.
24885395 Expression of CN2 in clinical colon tumors and colon cancer cell lines was significantly higher than that in normal colon mucosa cell lines. Knockdown of CNDP2 can inhibit the proliferation of colon cancer in vitro and retarded carcinogenesis in vivo.
24395568 Results suggest that CNDP2 acts as a functional tumor suppressor in gastric cancer via activation of the mitogen-activated protein kinase (MAPK) pathway.
22410244 a key role of CNDP2 in PD neurodegeneration, by mechanisms that could involve oxidative stress, protein aggregation or inflammation.
22128300 deletion of the CPGL gene is a poor prognostic marker in resected pancreatic cancer, and functional studies suggest the CPGL gene as growth suppressor gene in pancreatic cancer.
21573905 Common variants in CNDP1 and CNDP2 play a role in susceptibility to kidney disease in patients with type 2 diabetes.
20199107 the crystal structure of the flop-selective allosteric modulator, PEPA, bound to the binding domains of the GluA2 and GluA3 flop isoforms of AMPA receptors
19373489 Observational study of gene-disease association. (HuGE Navigator)
18753673 Our large, comprehensive study did not find an association between the D18S880 microsatellite or any other polymorphisms in the CNDP2-CNDP1 genomic region and susceptibility for diabetic nephropathy in type 1 diabetes
18753673 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAALTTLFKYIDENQDRYIKKLAKWVAIQSVSAWPEKRGEIRRMMEVAAADVKQLGGSVELVDIGKQKLP      1 - 70
DGSEIPLPPILLGRLGSDPQKKTVCIYGHLDVQPAALEDGWDSEPFTLVERDGKLYGRGSTDDKGPVAGW     71 - 140
INALEAYQKTGQEIPVNVRFCLEGMEESGSEGLDELIFARKDTFFKDVDYVCISDNYWLGKKKPCITYGL    141 - 210
RGICYFFIEVECSNKDLHSGVYGGSVHEAMTDLILLMGSLVDKRGNILIPGINEAVAAVTEEEHKLYDDI    211 - 280
DFDIEEFAKDVGAQILLHSHKKDILMHRWRYPSLSLHGIEGAFSGSGAKTVIPRKVVGKFSIRLVPNMTP    281 - 350
EVVGEQVTSYLTKKFAELRSPNEFKVYMGHGGKPWVSDFSHPHYLAGRRAMKTVFGVEPDLTREGGSIPV    351 - 420
TLTFQEATGKNVMLLPVGSADDGAHSQNEKLNRYNYIEGTKMLAAYLYEVSQLKD                   421 - 475
//

Text Mined References (29)

PMID Year Title
25964343 2015 N-lactoyl-amino acids are ubiquitous metabolites that originate from CNDP2-mediated reverse proteolysis of lactate and amino acids.
24885395 2014 Up-regulation of CNDP2 facilitates the proliferation of colon cancer.
24395568 2014 Underexpressed CNDP2 participates in gastric cancer growth inhibition through activating the MAPK signaling pathway.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23396134 2013 Genome-wide meta-analyses of multiancestry cohorts identify multiple new susceptibility loci for refractive error and myopia.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22410244 2012 Proteomic profiling of the substantia nigra demonstrates CNDP2 overexpression in Parkinson's disease.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22128300 2012 Loss of 18q22.3 involving the carboxypeptidase of glutamate-like gene is associated with poor prognosis in resected pancreatic cancer.
21573905 2011 Common variants in CNDP1 and CNDP2, and risk of nephropathy in type 2 diabetes.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20199107 2010 Molecular mechanism of flop selectivity and subsite recognition for an AMPA receptor allosteric modulator: structures of GluA2 and GluA3 in complexes with PEPA.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19373489 2009 The influence of carnosinase gene polymorphisms on diabetic nephropathy risk in African-Americans.
19346245 2009 Dug1p Is a Cys-Gly peptidase of the gamma-glutamyl cycle of Saccharomyces cerevisiae and represents a novel family of Cys-Gly peptidases.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18753673 2008 Exclusion of polymorphisms in carnosinase genes (CNDP1 and CNDP2) as a cause of diabetic nephropathy in type 1 diabetes: results of large case-control and follow-up studies.
17220478 2007 Proteomics analysis of the interactome of N-myc downstream regulated gene 1 and its interactions with the androgen response program in prostate cancer cells.
17121880 2006 Identification of carboxypeptidase of glutamate like-B as a candidate suppressor in cell growth and metastasis in human hepatocellular carcinoma.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12473676 2003 Sequence identification and characterization of human carnosinase and a closely related non-specific dipeptidase.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.