Property Summary

NCBI Gene PubMed Count 5
PubMed Score 173.96
PubTator Score 9.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
hepatocellular carcinoma 1.400 1.3e-04
glioblastoma 1.700 6.5e-08
ependymoma 1.300 2.9e-04
group 4 medulloblastoma 2.100 2.9e-05
atypical teratoid/rhabdoid tumor 1.900 1.5e-05
primitive neuroectodermal tumor 1.500 6.3e-07
juvenile dermatomyositis 1.014 2.5e-06
intraductal papillary-mucinous neoplasm ... 1.500 2.2e-02
Breast cancer 2.600 4.5e-02
pediatric high grade glioma 1.700 5.4e-06
pilocytic astrocytoma 1.500 4.9e-05
ovarian cancer -2.200 4.7e-06

Gene RIF (2)

PMID Text
24402442 Crystal structures of the active CMTr2 catalytic domain in complex with a methyl group donor and a capped oligoribonucleotide are examined, thereby revealing the mechanism of specific recognition of capped RNA.
21310715 A report on the validation of a human enzyme that methylates the ribose of the second transcribed nucleotide encoded by FTSJD1.

AA Sequence

MSKCRKTPVQQLASPASFSPDILADIFELFAKNFSYGKPLNNEWQLPDPSEIFTCDHTELNAFLDLKNSL      1 - 70
NEVKNLLSDKKLDEWHEHTAFTNKAGKIISHVRKSVNAELCTQAWCKFHEILCSFPLIPQEAFQNGKLNS     71 - 140
LHLCEAPGAFIASLNHYLKSHRFPCHWSWVANTLNPYHEANDDLMMIMDDRLIANTLHWWYFGPDNTGDI    141 - 210
MTLKFLTGLQNFISSMATVHLVTADGSFDCQGNPGEQEALVSSLHYCEVVTALTTLGNGGSFVLKMFTMF    211 - 280
EHCSINLMYLLNCCFDQVHVFKPATSKAGNSEVYVVCLHYKGREAIHPLLSKMTLNFGTEMKRKALFPHH    281 - 350
VIPDSFLKRHEECCVFFHKYQLETISENIRLFECMGKAEQEKLNNLRDCAIQYFMQKFQLKHLSRNNWLV    351 - 420
KKSSIGCSTNTKWFGQRNKYFKTYNERKMLEALSWKDKVAKGYFNSWAEEHGVYHPGQSSILEGTASNLE    421 - 490
CHLWHILEGKKLPKVKCSPFCNGEILKTLNEAIEKSLGGAFNLDSKFRPKQQYSCSCHVFSEELIFSELC    491 - 560
SLTECLQDEQVVVPSNQIKCLLVGFSTLRNIKMHIPLEVRLLESAELTTFSCSLLHDGDPTYQRLFLDCL    561 - 630
LHSLRELHTGDVMILPVLSCFTRFMAGLIFVLHSCFRFITFVCPTSSDPLRTCAVLLCVGYQDLPNPVFR    631 - 700
YLQSVNELLSTLLNSDSPQQVLQFVPMEVLLKGALLDFLWDLNAAIAKRHLHFIIQREREEIINSLQLQN    701 - 770
//

Text Mined References (7)

PMID Year Title
24402442 2014 Structural analysis of human 2'-O-ribose methyltransferases involved in mRNA cap structure formation.
21310715 2011 2'-O-ribose methylation of cap2 in human: function and evolution in a horizontally mobile family.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.