Property Summary

NCBI Gene PubMed Count 7
PubMed Score 42.51
PubTator Score 146.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
breast carcinoma 1.400 8.7e-16
cystic fibrosis 2.000 1.6e-03
intraductal papillary-mucinous neoplasm ... 2.500 7.4e-03
invasive ductal carcinoma 1.217 2.6e-03
juvenile dermatomyositis 4.611 1.3e-24
medulloblastoma -1.100 2.7e-02
medulloblastoma, large-cell -2.600 1.2e-03
ovarian cancer 2.100 7.8e-03
pancreatic cancer 1.100 1.7e-03
primary Sjogren syndrome 2.600 1.0e-05
psoriasis 2.200 4.6e-26
tuberculosis 1.700 7.0e-03

Gene RIF (3)

AA Sequence

MAFARRLLRGPLSGPLLGRRGVCAGAMAPPRRFVLELPDCTLAHFALGADAPGDADAPDPRLAALLGPPE      1 - 70
RSYSLCVPVTPDAGCGARVRAARLHQRLLHQLRRGPFQRCQLLRLLCYCPGGQAGGAQQGFLLRDPLDDP     71 - 140
DTRQALLELLGACQEAPRPHLGEFEADPRGQLWQRLWEVQDGRRLQVGCAQVVPVPEPPLHPVVPDLPSS    141 - 210
VVFPDREAARAVLEECTSFIPEARAVLDLVDQCPKQIQKGKFQVVAIEGLDATGKTTVTQSVADSLKAVL    211 - 280
LKSPPSCIGQWRKIFDDEPTIIRRAFYSLGNYIVASEIAKESAKSPVIVDRYWHSTATYAIATEVSGGLQ    281 - 350
HLPPAHHPVYQWPEDLLKPDLILLLTVSPEERLQRLQGRGMEKTREEAELEANSVFRQKVEMSYQRMENP    351 - 420
GCHVVDASPSREKVLQTVLSLIQNSFSEP                                             421 - 449
//

Text Mined References (10)

PMID Year Title