Property Summary

NCBI Gene PubMed Count 7
PubMed Score 98.82
PubTator Score 146.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
medulloblastoma -1.100 2.7e-02
medulloblastoma, large-cell -2.600 1.2e-03
juvenile dermatomyositis 4.611 1.3e-24
tuberculosis 1.700 7.0e-03
intraductal papillary-mucinous neoplasm ... 2.500 7.4e-03
pancreatic cancer 1.100 1.7e-03
cystic fibrosis 2.000 1.6e-03
primary Sjogren syndrome 2.600 1.0e-05
psoriasis 2.900 7.8e-13
invasive ductal carcinoma 1.800 1.1e-02
breast carcinoma 1.400 8.7e-16
ovarian cancer 2.100 7.8e-03

Gene RIF (3)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18498354 Upregulated in monocyte/macrophage differentiating cells, suggesting coordinated regulation with the terminal differentiation program.
17999954 a human mitochondrial UMP-CMP kinase (UMP-CMPK, cytidylate kinase; EC 2.7.4.14), designated as UMP-CMP kinase 2 (UMP-CMPK2), is identified.

AA Sequence

MAFARRLLRGPLSGPLLGRRGVCAGAMAPPRRFVLELPDCTLAHFALGADAPGDADAPDPRLAALLGPPE      1 - 70
RSYSLCVPVTPDAGCGARVRAARLHQRLLHQLRRGPFQRCQLLRLLCYCPGGQAGGAQQGFLLRDPLDDP     71 - 140
DTRQALLELLGACQEAPRPHLGEFEADPRGQLWQRLWEVQDGRRLQVGCAQVVPVPEPPLHPVVPDLPSS    141 - 210
VVFPDREAARAVLEECTSFIPEARAVLDLVDQCPKQIQKGKFQVVAIEGLDATGKTTVTQSVADSLKAVL    211 - 280
LKSPPSCIGQWRKIFDDEPTIIRRAFYSLGNYIVASEIAKESAKSPVIVDRYWHSTATYAIATEVSGGLQ    281 - 350
HLPPAHHPVYQWPEDLLKPDLILLLTVSPEERLQRLQGRGMEKTREEAELEANSVFRQKVEMSYQRMENP    351 - 420
GCHVVDASPSREKVLQTVLSLIQNSFSEP                                             421 - 449
//

Text Mined References (10)

PMID Year Title
23416111 2013 The human adenylate kinase 9 is a nucleoside mono- and diphosphate kinase.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18498354 2008 Identification of a putative human mitochondrial thymidine monophosphate kinase associated with monocytic/macrophage terminal differentiation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17999954 2008 Human UMP-CMP kinase 2, a novel nucleoside monophosphate kinase localized in mitochondria.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.