Property Summary

NCBI Gene PubMed Count 29
PubMed Score 96.25
PubTator Score 54.49

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (1)

Gene RIF (10)

AA Sequence

MKPLVVFVLGGPGAGKGTQCARIVEKYGYTHLSAGELLRDERKNPDSQYGELIEKYIKEGKIVPVEITIS      1 - 70
LLKREMDQTMAANAQKNKFLIDGFPRNQDNLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSSGR     71 - 140
SDDNRESLEKRIQTYLQSTKPIIDLYEEMGKVKKIDASKSVDEVFDEVVQIFDKEG                  141 - 196
//

Text Mined References (34)

PMID Year Title