Property Summary

NCBI Gene PubMed Count 44
PubMed Score 115.99
PubTator Score 48.64

Knowledge Summary

Patent (25,942)

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
cutaneous lupus erythematosus 1.100 1.6e-02
adrenocortical carcinoma -1.058 5.0e-05
interstitial cystitis 1.700 3.7e-04
sonic hedgehog group medulloblastoma 1.200 8.3e-04
lung adenocarcinoma -2.100 1.6e-09
lung carcinoma -1.600 3.0e-15

 CSPA Cell Line (1)

Gene RIF (32)

PMID Text
25637017 ChemR23, the receptor for chemerin and resolvin E1, is expressed and functional on M1 but not on M2 macrophages.
25627894 Gestational obesity and gestational diabetes mellitus may contribute to elevated serum chemerin. Serum chemerin in pregnancy was associated with insulin resistance and triglycerides. Chemerin gene may play a role both in obese and gestational diabetes mellitus patients
25539827 Increased chemerin expression in dermal blood vessels may be associated with the development of digital ulcers in systemic sclerosis.
25121101 The study for the first time confirmed a marked expression of chemerin and CMKLR1 in the liver of chronic hepatitis patients.
25079809 Results indicate that Abeta42 activates CMKLR1, leading to glia cell migration and clearance of Abeta42; and is involved in Abeta processing and clearance
25030943 The effects of diclofenac on the incidence of pancreatitis following endoscopic retrograde cholangiopancreatography via lipoxin A4 and resolvin D1 and E1 levels is reported.
24779513 Results lend some support to a presumable role of locally produced chemerin in the progression of atherosclerotic lesions, possibly acting through its CMKLR1 receptor.
24689495 This study identified the up-regulation of ChemR23 in post-traumatic injury of calcaneal articular fracture
24659779 Development of a membrane-anchored chemerin receptor agonist as a novel modulator of allergic airway inflammation and neuropathic pain.
23999103 ChemR23 is expressed in neutrophil granules and rapidly upregulated upon neutrophil activation.
23904282 Chemerin receptor showed increased expression in the lymph nodes and the spleen.
23495698 Prochemerin processing protease converts prochemerin into active chemerinF; the activating truncation by the protease may trigger a structural C-terminal rearrangement leading to increased affinity of chemerin to chemokine-like receptor (CMKLR)1.
23469143 ChemR23 forms homomers, and provide data suggesting that ChemR23 also forms heteromers with the chemokine receptors CCR7 and CXCR4.
22842622 HIV-1 isolates showing CCR3 tropism are particularly efficient in using CMKLR1/ChemR23 as a co-receptor; some HIV-2 and SIV isolates also use CMKLR1/ChemR23
22768214 These results rule out the direct anti-inflammatory effect of chemerin on macrophages ex vivo, described previously in the literature, despite the expression of a functional ChemR23 receptor in these cells.
22610747 review of current research on biological roles of chemerin and chemokine-like receptor 1; highlight roles in mediating obesity and development of type 2 diabetes [REVIEW]
21959042 The interaction of chemerin and ChemR23 may play an important role in the pathogenesis of rheumatoid arthritis through the resultant activation of fibroblast-like synoviocytes.
21715684 Chemerin, a ligand for the G-protein coupled receptor chemokine-like receptor 1, requires carboxy-terminal proteolytic processing to unleash its chemoattractant activity
21483023 A genetic variation in the chemokine-like receptor 1 (CMKLR1) gene was statistically significantly associated with decreased overall survival in the three individual populations as well as in pooled analyses.
21346723 The ChemR23/Chemerin axis may have a role in the recruitment of dendritic cells within the kidney in patients affected by lupus nephritis.
21192818 These results demonstrate that human chondrocytes express both the receptor ChemR23 and the ligand chemerin...which may play pivotal roles in joint inflammation.
20921899 HIV-1 isolates showing CCR3 tropism are particularly efficient in using CMKLR1/ChemR23 as a co-receptor; some HIV-2 and SIV isolates also use CMKLR1/ChemR23
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20044979 the presence of ChemR23 in human endothelial cells, its significant up-regulation by pro-inflammatory cytokines, and its role in angiogenesis were demonstrated.
19906641 RvE1 initiates direct activation of ChemR23 and signals receptor-dependent phosphorylation
19168032 CMKLR1 is expressed by circulating pDC in normal individuals and patients suffering from skin diseases, such as psoriasis and atopic dermatitis.
18976975 Knockdown of chemokine-like receptor 1 (CMKLR1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18564921 Observational study of gene-disease association. (HuGE Navigator)
16904155 The results strongly support that the chemerin receptor, in the presence of CD4, functions as a "minor co-receptor" promoting infection by HIV-1, HIV-2 and SIV.
16904155 HIV-1 isolates showing CCR3 tropism are particularly efficient in using CMKLR1/ChemR23 as a co-receptor; some HIV-2 and SIV isolates also use CMKLR1/ChemR23
15753205 ChemR23 mediates the Resolvin E1 signal to attenuate nuclear factor-kappaB

AA Sequence

MRMEDEDYNTSISYGDEYPDYLDSIVVLEDLSPLEARVTRIFLVVVYSIVCFLGILGNGLVIIIATFKMK      1 - 70
KTVNMVWFLNLAVADFLFNVFLPIHITYAAMDYHWVFGTAMCKISNFLLIHNMFTSVFLLTIISSDRCIS     71 - 140
VLLPVWSQNHRSVRLAYMACMVIWVLAFFLSSPSLVFRDTANLHGKISCFNNFSLSTPGSSSWPTHSQMD    141 - 210
PVGYSRHMVVTVTRFLCGFLVPVLIITACYLTIVCKLQRNRLAKTKKPFKIIVTIIITFFLCWCPYHTLN    211 - 280
LLELHHTAMPGSVFSLGLPLATALAIANSCMNPILYVFMGQDFKKFKVALFSRLVNALSEDTGHSSYPSH    281 - 350
RSFTKMSSMNERTSMNERETGML                                                   351 - 373
//

Text Mined References (49)

PMID Year Title
25637017 2015 ChemR23, the receptor for chemerin and resolvin E1, is expressed and functional on M1 but not on M2 macrophages.
25627894 2015 Chemerin expression in Chinese pregnant women with and without gestational diabetes mellitus.
25539827 2015 Increased expression of chemerin in endothelial cells due to Fli1 deficiency may contribute to the development of digital ulcers in systemic sclerosis.
25121101 2014 Hepatic chemerin and chemokine-like receptor 1 expression in patients with chronic hepatitis C.
25079809 2015 The chemerin receptor CMKLR1 is a functional receptor for amyloid-? peptide.
25030943 2014 Effect of diclofenac on the levels of lipoxin A4 and Resolvin D1 and E1 in the post-ERCP pancreatitis.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24779513 2014 Chemerin and CMKLR1 expression in human arteries and periadventitial fat: a possible role for local chemerin in atherosclerosis?
24709693 2014 Genome-wide data reveal novel genes for methotrexate response in a large cohort of juvenile idiopathic arthritis cases.
24689495 2014 Up-regulation of the chemo-attractive receptor ChemR23 and occurrence of apoptosis in human chondrocytes isolated from fractured calcaneal osteochondral fragments.
24659779 2014 Development of a membrane-anchored chemerin receptor agonist as a novel modulator of allergic airway inflammation and neuropathic pain.
23999103 2013 Chemerin15 inhibits neutrophil-mediated vascular inflammation and myocardial ischemia-reperfusion injury through ChemR23.
23904282 2013 Chemerin is expressed mainly in pancreas and liver, is regulated by energy deprivation, and lacks day/night variation in humans.
23495698 2013 Proteolytic activation of prochemerin by kallikrein 7 breaks an ionic linkage and results in C-terminal rearrangement.
23469143 2013 Consequences of ChemR23 heteromerization with the chemokine receptors CXCR4 and CCR7.
22768214 2012 The chemerin/ChemR23 system does not affect the pro-inflammatory response of mouse and human macrophages ex vivo.
22688191 2012 Genome-wide association study in a Swedish population yields support for greater CNV and MHC involvement in schizophrenia compared with bipolar disorder.
22610747 2012 Chemerin: a potential endocrine link between obesity and type 2 diabetes.
21959042 2011 Chemerin activates fibroblast-like synoviocytes in patients with rheumatoid arthritis.
21715684 2011 Regulation of chemerin chemoattractant and antibacterial activity by human cysteine cathepsins.
21483023 2011 Genome-wide association study of survival in non-small cell lung cancer patients receiving platinum-based chemotherapy.
21346723 2011 The possible role of ChemR23/Chemerin axis in the recruitment of dendritic cells in lupus nephritis.
21192818 2010 Human articular chondrocytes express ChemR23 and chemerin; ChemR23 promotes inflammatory signalling upon binding the ligand chemerin(21-157).
20932654 2010 Genome-wide association study to identify single nucleotide polymorphisms (SNPs) associated with the development of erectile dysfunction in African-American men after radiotherapy for prostate cancer.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20044979 2010 Identification of chemerin receptor (ChemR23) in human endothelial cells: chemerin-induced endothelial angiogenesis.
19906641 2010 Resolvin E1 receptor activation signals phosphorylation and phagocytosis.
19443732 2009 Epithelial cells in fetal intestine produce chemerin to recruit macrophages.
19168032 2009 Potential role of chemerin in recruitment of plasmacytoid dendritic cells to diseased skin.
18564921 2008 Candidate gene analysis in primary lymphedema.
18242188 2008 Chemerin enhances insulin signaling and potentiates insulin-stimulated glucose uptake in 3T3-L1 adipocytes.
16904155 2006 Characterization of the human chemerin receptor--ChemR23/CMKLR1--as co-receptor for human and simian immunodeficiency virus infection, and identification of virus-binding receptor domains.
16863918 2006 Chemokine-like receptor 1 expression by macrophages in vivo: regulation by TGF-beta and TLR ligands.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15753205 2005 Stereochemical assignment, antiinflammatory properties, and receptor for the omega-3 lipid mediator resolvin E1.
15728234 2005 Role of ChemR23 in directing the migration of myeloid and plasmacytoid dendritic cells to lymphoid organs and inflamed skin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14759258 2004 An unappreciated role for RNA surveillance.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14675762 2003 Characterization of human circulating TIG2 as a ligand for the orphan receptor ChemR23.
14530373 2003 Specific recruitment of antigen-presenting cells by chemerin, a novel processed ligand from human inflammatory fluids.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9603476 1998 ChemR23, a putative chemoattractant receptor, is expressed in monocyte-derived dendritic cells and macrophages and is a coreceptor for SIV and some primary HIV-1 strains.
9425281 1997 Molecular cloning and tissue distribution of cDNA encoding a novel chemoattractant-like receptor.
9144535 1997 A novel G protein-coupled receptor with homology to neuropeptide and chemoattractant receptors expressed during bone development.
8976386 1996 Molecular cloning of a novel receptor (CMKLR1) with homology to the chemotactic factor receptors.