Property Summary

NCBI Gene PubMed Count 25
PubMed Score 29.03
PubTator Score 18.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytoma -1.100 4.3e-20
glioblastoma multiforme -1.100 3.2e-19
oligodendroglioma -1.100 2.9e-20
osteosarcoma -1.084 1.6e-02
atypical teratoid / rhabdoid tumor -1.100 1.5e-04
adult high grade glioma -1.100 1.5e-03
group 3 medulloblastoma -1.800 2.9e-03
posterior fossa group B ependymoma -1.400 4.2e-09
lung adenocarcinoma 1.100 1.2e-04
lung carcinoma 2.100 5.0e-30
ovarian cancer -1.400 2.4e-05
pituitary cancer -2.100 2.1e-06

Gene RIF (13)

PMID Text
24067439 Results suggest that c-mip and RelA define two distinct types of renal damage associated with VEGF-targeted therapies.
23302718 c-mip has an active role in the podocyte disorders of membranous nephropathy.
22507836 These results suggest that alterations in NF-kappaB activity might result from the up-regulation of c-mip and are likely to contribute to podocyte disorders in cases of idiopathic nephrotic syndrome.
21493956 Eight suggestive significant loci were detected with a series of genes expressed within the inner ear that underlie the auditory function, such as: DCLK1, PTPRD, GRM8, CMIP.
21457949 we provide novel evidence that the language-disorder candidate gene CMIP is implicated in reading processes.
20484117 results identify c-mip as a key component in the molecular pathogenesis of acquired podocyte diseases
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20200355 Induction of c-mip in Hodgkin-Reed Sternberg cells and podocytes is associated with minimal change nephrotic syndrome in classical Hodgkin lymphoma.
20018188 Data demonstrate that c-mip interacts with Dip1 and upregulates DAPK, which blocks the nuclear translocation of ERK1/2.
19646677 CMIP modulates phonological short-term memory in language impairment.
19019440 c-mip inhibits the degradation of I-kappaBalpha and impedes the dissociation of the NF-kappaB/I-kappaBalpha complexes.
15128042 Filamin-A interacts with c-mip/Tc-mip in a new T-cell signaling pathway.
12939343 results suggest that Tc-mip plays a critical role in Th2 signaling pathway and represents the first proximal signaling protein which links TCR-mediated signal to the activation of c-maf Th2 specific factor

AA Sequence

MDVTSSSGGGGDPRQIEETKPLLGGDVSAPEGTKMGAVPCRRALLLCNGMRYKLLQEGDIQVCVIRHPRT      1 - 70
FLSKILTSKFLRRWEPHHLTLADNSLASATPTGYMENSVSYSAIEDVQLLSWENAPKYCLQLTIPGGTVL     71 - 140
LQAANSYLRDQWFHSLQWKKKIYKYKKVLSNPSRWEVVLKEIRTLVDMALTSPLQDDSINQAPLEIVSKL    141 - 210
LSENTNLTTQEHENIIVAIAPLLENNHPPPDLCEFFCKHCRERPRSMVVIEVFTPVVQRILKHNMDFGKC    211 - 280
PRLRLFTQEYILALNELNAGMEVVKKFIQSMHGPTGHCPHPRVLPNLVAVCLAAIYSCYEEFINSRDNSP    281 - 350
SLKEIRNGCQQPCDRKPTLPLRLLHPSPDLVSQEATLSEARLKSVVVASSEIHVEVERTSTAKPALTASA    351 - 420
GNDSEPNLIDCLMVSPACSTMSIELGPQADRTLGCYVEILKLLSDYDDWRPSLASLLQPIPFPKEALAHE    421 - 490
KFTKELKYVIQRFAEDPRQEVHSCLLSVRAGKDGWFQLYSPGGVACDDDGELFASMVHILMGSCYKTKKF    491 - 560
LLSLAENKLGPCMLLALRGNQTMVEILCLMLEYNIIDNNDTQLQIISTLESTDVGKRMYEQLCDRQRELK    561 - 630
ELQRKGGPTRLTLPSKSTDADLARLLSSGSFGNLENLSLAFTNVTSACAEHLIKLPSLKQLNLWSTQFGD    631 - 700
AGLRLLSEHLTMLQVLNLCETPVTDAGLLALSSMKSLCSLNMNSTKLSADTYEDLKAKLPNLKEVDVRYT    701 - 770
EAW                                                                       771 - 773
//

Text Mined References (32)

PMID Year Title
25352737 2014 Electronic medical records and genomics (eMERGE) network exploration in cataract: several new potential susceptibility loci.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24105470 2014 A meta-analysis of genome-wide association studies for adiponectin levels in East Asians identifies a novel locus near WDR11-FGFR2.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
24067439 2014 Expression patterns of RelA and c-mip are associated with different glomerular diseases following anti-VEGF therapy.
23667675 2013 Genome wide association study of age at menarche in the Japanese population.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
23302718 2013 Upregulation of c-mip is closely related to podocyte dysfunction in membranous nephropathy.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22507836 2012 c-mip down-regulates NF-?B activity and promotes apoptosis in podocytes.
22479202 2012 Novel loci for adiponectin levels and their influence on type 2 diabetes and metabolic traits: a multi-ethnic meta-analysis of 45,891 individuals.
22158537 2011 Meta-analysis of genome-wide association studies identifies eight new loci for type 2 diabetes in east Asians.
21493956 2011 Hearing function and thresholds: a genome-wide association study in European isolated populations identifies new loci and pathways.
21457949 2011 DCDC2, KIAA0319 and CMIP are associated with reading-related traits.
21269460 2011 Initial characterization of the human central proteome.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20484117 2010 c-mip impairs podocyte proximal signaling and induces heavy proteinuria.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20200355 2010 Occurrence of minimal change nephrotic syndrome in classical Hodgkin lymphoma is closely related to the induction of c-mip in Hodgkin-Reed Sternberg cells and podocytes.
20018188 2010 C-mip interacts with the p85 subunit of PI3 kinase and exerts a dual effect on ERK signaling via the recruitment of Dip1 and DAP kinase.
19646677 2009 CMIP and ATP2C2 modulate phonological short-term memory in language impairment.
19019440 2009 C-mip interacts physically with RelA and inhibits nuclear factor kappa B activity.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
16341674 2005 Transcriptome analysis of human gastric cancer.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15128042 2004 The Filamin-A is a partner of Tc-mip, a new adapter protein involved in c-maf-dependent Th2 signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12939343 2003 Truncation of C-mip (Tc-mip), a new proximal signaling protein, induces c-maf Th2 transcription factor and cytoskeleton reorganization.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11214970 2000 Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.