Property Summary

NCBI Gene PubMed Count 13
PubMed Score 13.20
PubTator Score 22.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Cancer 2346 0.0 4.0
Disease Target Count Z-score Confidence
Ataxia telangiectasia 32 3.555 1.8
Thoracic aortic aneurysm 13 3.067 1.5

Synonym

Accession P56277 Q5HYP9
Symbols p8
C6.1B
MTCP1
MTCP1B
MTCP1NB
p8MTCP1

Gene

PDB

1EI0   1HP8   2HP8  

  Ortholog (1)

Species Source Disease
Cow OMA Inparanoid

AA Sequence

MPQKDPCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKSASK        1 - 68
//

Text Mined References (15)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
20922212 2010 Genome-wide analysis of eukaryotic twin CX9C proteins.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16381901 2006 The LIFEdb database in 2006.
15772651 2005 The DNA sequence of the human X chromosome.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.
11076863 2000 DNA cloning using in vitro site-specific recombination.
9405159 1997 Solution structure of human p8MTCP1, a cysteine-rich protein encoded by the MTCP1 oncogene, reveals a new alpha-helical assembly motif.
8361760 1993 MTCP-1: a novel gene on the human chromosome Xq28 translocated to the T cell receptor alpha/delta locus in mature T cell proliferations.
7970717 1994 The MTCP-1/c6.1B gene encodes for a cytoplasmic 8 kD protein overexpressed in T cell leukemia bearing a t(X;14) translocation.
7784073 1995 The 8 kD product of the putative oncogene MTCP-1 is a mitochondrial protein.
1303175 1992 Isolation and sequence of two genes associated with a CpG island 5' of the factor VIII gene.