Property Summary

NCBI Gene PubMed Count 13
PubMed Score 10.05
PubTator Score 22.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Cancer 2499 0.0 4.0
Disease Target Count Z-score Confidence
Thoracic aortic aneurysm 15 3.348 1.7
Moyamoya disease 10 3.027 1.5

Expression

AA Sequence

MPQKDPCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKSASK        1 - 68
//

Text Mined References (15)

PMID Year Title