Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00
PubTator Score 32.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Gene RIF (2)

AA Sequence

MALDPADQHLRHVEKDVLIPKIMREKAKERCSEQVQDFTKCCKNSGVLMVVKCRKENSALKECLTAYYND      1 - 70
PAFYEECKMEYLKEREEFRKTGIPTKKRLQKLPTSM                                       71 - 106
//

Text Mined References (11)

PMID Year Title