Property Summary

NCBI Gene PubMed Count 9
PubMed Score 76.21
PubTator Score 45.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
cystic fibrosis -1.200 1.0e-02
Duchenne muscular dystrophy -1.298 1.3e-06
intraductal papillary-mucinous adenoma (... 1.700 7.9e-05
intraductal papillary-mucinous neoplasm ... 1.300 8.0e-03
interstitial cystitis -1.400 1.0e-03
atypical teratoid/rhabdoid tumor 1.100 4.5e-05
subependymal giant cell astrocytoma 1.960 2.3e-02
psoriasis -1.200 1.1e-06
lung carcinoma 1.700 1.8e-20
ulcerative colitis -1.700 1.6e-05
ovarian cancer -2.100 3.0e-04
pituitary cancer -1.200 2.6e-03
chronic rhinosinusitis -1.320 8.3e-03

Synonym

Accession Q96DG6 D3DTC7 Q8TED6
Symbols JS-1

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

PMID Text
20177059 By comparing the enzyme kinetics and chemical inhibition properties between the recombinant protein and tissue preparations, CMBL was shown to be the primary olmesartan medoxomil bioactivating enzyme in the liver and intestine.

AA Sequence

MANEAYPCPCDIGHRLEYGGLGREVQVEHIKAYVTKSPVDAGKAVIVIQDIFGWQLPNTRYIADMISGNG      1 - 70
YTTIVPDFFVGQEPWDPSGDWSIFPEWLKTRNAQKIDREISAILKYLKQQCHAQKIGIVGFCWGGTAVHH     71 - 140
LMMKYSEFRAGVSVYGIVKDSEDIYNLKNPTLFIFAENDVVIPLKDVSLLTQKLKEHCKVEYQIKTFSGQ    141 - 210
THGFVHRKREDCSPADKPYIDEARRNLIEWLNKYM                                       211 - 245
//

Text Mined References (15)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20177059 2010 Human carboxymethylenebutenolidase as a bioactivating hydrolase of olmesartan medoxomil in liver and intestine.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16328025 2006 Transforming capacity of two novel genes JS-1 and JS-2 located in chromosome 5p and their overexpression in human esophageal squamous cell carcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
3804974 1987 Nucleotide sequence and expression of clcD, a plasmid-borne dienelactone hydrolase gene from Pseudomonas sp. strain B13.