Property Summary

Ligand Count 347
NCBI Gene PubMed Count 112
PubMed Score 1121.10
PubTator Score 479.50

Knowledge Summary


No data available


  Differential Expression (6)

Disease log2 FC p
Atopic dermatitis -1.300 5.2e-03
cutaneous lupus erythematosus -1.400 1.8e-02
ductal carcinoma in situ -1.300 6.5e-04
invasive ductal carcinoma -1.900 3.7e-04
osteosarcoma -3.271 9.3e-05
psoriasis -1.700 7.1e-03

Gene RIF (89)

AA Sequence

GVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN                                     211 - 247

Text Mined References (115)

PMID Year Title