Property Summary

NCBI Gene PubMed Count 109
PubMed Score 1084.88
PubTator Score 479.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
cutaneous lupus erythematosus -1.400 1.8e-02
psoriasis -1.700 7.1e-03
osteosarcoma -3.271 9.3e-05
Atopic dermatitis -1.300 5.2e-03
ductal carcinoma in situ -1.300 6.5e-04
invasive ductal carcinoma -1.900 3.7e-04

Protein-protein Interaction (5)

Gene RIF (88)

PMID Text
25797204 promoter single nucleotide polymorphism is not associated with Dengue Hemorrhagic Fever and Dengue Shock Syndrome in Vietnam and Philippines
25120737 Our data demonstrated that mast cell chymase plays an important role in keloid formation through TGF-beta1/Smad signaling pathway.
25119908 CMA1 gene single nucleotide polymorphisms is associated with essential hypertension.
25102745 Significant association between the AG genotype of CMA1 A polymorphism and Angina Pectoris and Ventricular Extrasystoles was observed.
24874976 we present data indicating that MC tryptase and chymase contribute to the development of OSF and malignant transformation of the overlying epithelium.
24823657 The polymorphisms and haplotypes of the CMA1 locus are associated with cardiac hypertrophy in male patients with symptomatic aortic stenosis.
24560885 demonstrate the generation of Pso p27 from SCCA1 with extracts from psoriatic scale and even more remarkably, the generation of Pso p27 from SCCA1 in the presence of mast cell associated chymase
24516344 These data suggest a possible contribution of human chymase activation to LPS-induced mortality
24507159 The accumulated data in this review suggest that mast cells, their tryptases, and their chymases play important roles in tissue repair.
24344642 Purified chymase mixed with fragmented heparin derived from heparanase-expressing cells show greater release from collagen gels than the enzyme alone or mixed with macromolecular heparin derived from mock cells.
24257755 Mast cell chymase degrades the alarmins heat shock protein 70, biglycan, HMGB1, and interleukin-33 (IL-33) and limits danger-induced inflammation.
22679278 The present results indicated PRCP rs7104980 can be considered as a marker for EH and Hap3 GAGCACTAACA (PRCP) and Hap16 TTTA (CMA1) might be associated with essential hypertension in Chinese Han population.
22653218 Data indicate that the best Fynomer (the binding proteins derived from the Fyn SH3 domain) was found to bind chymase with a KD of 0.9 nM and koff of 6.6x10 (-4) s (-1) , and to selectively inhibit chymase activity with an IC 50 value of 2 nM.
22363824 As mast cells are an important source of VEGF, tryptase, and chymase, these findings suggest that mast cell activation and mast cell-derived mediators participate in the development of Dengue hemorrhagic fever.
22194960 Both IgE and chymase associate with diabetes status.
22180785 a dominant role of cardiac chymase in the formation of Ang II from Ang-(1-12)
22102069 Two different populations of mast cells were found in melanocytic skin; one expressing both chymase and tryptase and the other with tryptase only.
21796807 Polymorphism rs1800875 of CMA1 may be associated with serum IgE level in coronary heart disease subjects, but not with chymase level in normal coronary intimae
21786536 human chymase contributes to blood glucose levels and mortality during the progression of diabetes
21274549 mast cell-derived protein is present in uterine cervical carcinoma
21150220 Chymase rs1800875 polymorphism is associated with the progression of immunoglobulin A (IgA) nephropathy in Korean patients.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20736038 short tandem repeat genetic polymorphism is associated with bronchial asthma in a Swiss cohort study
20736038 Observational study of gene-disease association. (HuGE Navigator)
20670150 Elevated maternal chymase activity and enhanced protease immunostaining in the maternal vessel endothelium may constitute the exacerbated inflammatory state and account for the increased vascular Ang II sensitivity in preeclampsia.
20659024 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20424473 Observational study of gene-disease association. (HuGE Navigator)
20423454 Positions 143 (Arg) and 192 (Lys) in human mast cell chymase contribute to the strong preference for negatively charged amino acids at substrate position P2'.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19899640 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19853701 Observational study of gene-disease association. (HuGE Navigator)
19697770 The levels of tryptase and chymase expression are greatly increased in human lung tissue of anaphylactic shock.
19520069 Observational study of gene-disease association. (HuGE Navigator)
19494363 activation of endothelial CLP/chymase may directly relate to the increased inflammatory phenotypic changes in the vascular system in women with preeclampsia
19380825 After secretion by mast cells, alpha 2-macroglobulin-bound chymase remains accessible to small substrates, including angiotensin I, with activity in serum that is stable with prolonged incubation.
19332265 Observational study of gene-disease association. (HuGE Navigator)
19126871 Placenta-derived chymotrypsin-like protease contributes to the altered endothelial barrier function in preeclampsia.
18973102 positive association between the CMA1 -1903 G/A single nucleotide polymorphism and bronchial asthma in children in Egypt
18973102 Observational study of gene-disease association. (HuGE Navigator)
18958543 In Japan, carriage of the MMP-7-181 G allele and of the CMA/B A allele were each associated with an increased risk for H. pylori-related noncardia gastric cancer development.
18958543 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18856058 Observational study of gene-disease association. (HuGE Navigator)
18845543 epithelial chymase is rapidly activated by a ligand-independent mechanism following mechanical stress via cytoskeletal and reactive oxygen species signaling and is associated with the onset of epithelial cell migration
18641516 Observational study of gene-disease association. (HuGE Navigator)
18079408 chymase inactivates the FAK-mediated cell survival signaling
17851694 Observational study of gene-disease association. (HuGE Navigator)
17460374 Chymase promoted the migration of vascular smooth muscle cells in the matrix-coated invasion chambers and activated promatrix metalloproteinase-2 obtained from the culture medium of vascular smooth muscle cells.
17334631 These observations suggest that mast cell chymase, possibly induced by interleukin-4-dependent phenotypic modulation, may be an important mediator in the inflammatory and fibrotic processes of idiopathic interstitial pneumonia in humans.
17199219 cardiac chymase activity appears to be involved in cardiac remodelling--REVIEW
17035401 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16962475 There was higher angiotensin-converting enzyme (ACE) and chymase mRNA expression and mast cell density in failing than in control myocardium and no changes in ACE2 expression were detected.
16786130 chymase in mast cells may have a role in inflammatory bowel disease
16520412 AGEs, a hallmark of diabetes, induce chymase via the RAGE-ERK1/2 MAP kinase pathway. Chymase initiates an important alternative angiotensin II-generating pathway in diabetes and may play a critical role in diabetic vascular disease.
16446531 Observational study of gene-disease association. (HuGE Navigator)
16446531 The CMA1 polymorphisms studied do not contribute to disease susceptibility in Japanese or Dutch sarcoidosis patients.
16317101 activated human skin mast cells (MCs) convert CTAP-III into biologically active NAP-2 through proteolytic cleavage by released chymase.
16134991 Observational study of gene-disease association. (HuGE Navigator)
16134991 Significant association between the CMA1 promoter polymorphism rs1800875 and atopic eczema supports the hypothesis that CMA1 serves as candidate gene for atopic eczema.
16020275 Chymase-induced apoptosis of conjunctival epithelial cells represents anoikis, which is a slowly occurring apoptotic process induced by lack of adhesion to an extracellular matrix.
15924217 Observational study of gene-disease association. (HuGE Navigator)
15924217 A novel (TG)n(GA)m repeat polymorphism 254 bp downstream of the mast cell chymase (CMA1) gene is associated with atopic asthma and total serum IgE levels.
15919053 mast cell chymase activates ERK and p38 probably through G-protein-coupled receptor, and the ERK but not p38 cascade may have a crucial role in chymase-induced migration of eosinophils
15914614 Observational study of gene-disease association. (HuGE Navigator)
15788353 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15638376 Tryptase and chymase and protein levels were determined in mast cells in fibrosarcoma.
15555355 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15449728 The synthesis of new potential inhibitors of human chymase is described
15248847 Observational study of gene-disease association. (HuGE Navigator)
15227657 Bladder fibrosis may be mediated by mast cell chymase stimulation of collagen synthesis.
15106801 mast cell chymase-1 is unlikely to influence blood pressure levels in the Japanese population.
14757520 MCT1 immunoreactivity was visible in blood vessel walls as early as the 13th week of gestation mainly in the visual cortical plate and subplate.
14701812 chymase depletes pre-beta-high density lipoprotein, which impairs ATP-binding cassette transporter A1- but not scavenger receptor class B type I-mediated lipid efflux to high density lipoprotein
14592513 new class of chymase inhibitor through a substituent analysis of MWP00965 chemically synthesized
12815038 albumin is a substrate of human chymase
12614156 Interactions among the loops bordering and defining the active site appear to influence both the zymogen and the activated conformations of chymase in this model.
12531890 Degradation of phospholipid transfer protein (PLTP) and PLTP-generated pre-beta-high density lipoprotein by this enzyme in mast cells impairs high affinity efflux of cholesterol from macrophage foam cells.
12484503 Both the ACE and chymase-like enzyme activities in the aneurysmal aortae were significantly higher than those in the control aortae.
12446192 Observational study of gene-disease association. (HuGE Navigator)
12359984 Chymase may play a role in heart remodeling by increasing Ang II formation and activating MMP-9, and the regulation of collagen I gene expression.
12165749 Results suggest the additive effect of angiotensin I-converting enzyme (ACE) and heart chymase (CMA) gene polymorphisms on the increase in left ventricular mass in NIDDM patients.
12097409 The local release of mast cell chymase has potentially profound effects on airway smooth muscle cell function by disruption of the cell-associated matrix and inhibition of epidermal growth factor-induced smooth muscle cell proliferation.
12047032 The mast cell chymase A3255 allele was shown to have an effect on HDL cholesterol metabolism.
11852067 The S1 primary specificity pocket defines substrate specificity of chymases.
11696688 Observational study of gene-disease association. (HuGE Navigator)
11303326 Observational study of gene-disease association. (HuGE Navigator)
11208365 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11096141 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGR      1 - 70
SITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPP     71 - 140
GRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCA    141 - 210
GVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN                                     211 - 247
//

Text Mined References (112)

PMID Year Title
25797204 2015 Alpha tryptase allele of Tryptase 1 (TPSAB1) gene associated with Dengue Hemorrhagic Fever (DHF) and Dengue Shock Syndrome (DSS) in Vietnam and Philippines.
25120737 2014 Mast cell chymase in keloid induces profibrotic response via transforming growth factor-?1/Smad activation in keloid fibroblasts.
25119908 2014 [Association of CMA1 gene tag single nucleotide polymorphisms with essential hypertension in Yi population from Yunnan].
25102745 2014 [Renin-angiotensin-aldosterone system in hypertrophic cardiomyopathy].
24874976 2014 Altered immunohistochemical expression of mast cell tryptase and chymase in the pathogenesis of oral submucous fibrosis and malignant transformation of the overlying epithelium.
24823657 2014 Association of the common genetic polymorphisms and haplotypes of the chymase gene with left ventricular mass in male patients with symptomatic aortic stenosis.
24560885 2014 Psoriasis pathogenesis - Pso p27 is generated from SCCA1 with chymase.
24516344 2014 Chymase activities and survival in endotoxin-induced human chymase transgenic mice.
24507159 2014 Development of mast cells and importance of their tryptase and chymase serine proteases in inflammation and wound healing.
24344642 2014 Heparanase-mediated cleavage of macromolecular heparin accelerates release of granular components of mast cells from extracellular matrices.
24257755 2014 Mast cell chymase degrades the alarmins heat shock protein 70, biglycan, HMGB1, and interleukin-33 (IL-33) and limits danger-induced inflammation.
22679278 2013 Association of polymorphisms in prolylcarboxypeptidase and chymase genes with essential hypertension in the Chinese Han population.
22653218 Generation, characterization and structural data of chymase binding proteins based on the human Fyn kinase SH3 domain.
22363824 2012 Association of mast cell-derived VEGF and proteases in Dengue shock syndrome.
22194960 2011 Immunoglobulin E and mast cell proteases are potential risk factors of human pre-diabetes and diabetes mellitus.
22180785 2011 Chymase-dependent generation of angiotensin II from angiotensin-(1-12) in human atrial tissue.
22102069 2011 Mast cells in melanocytic skin lesions. An immunohistochemical and quantitative study.
21796807 2011 Association between SNP rs1800875, serum chymase and immunoglobulin E levels in patients with coronary heart disease.
21786536 2011 Blood glucose level and survival in streptozotocin-treated human chymase transgenic mice.
21274549 2011 Mast cell chymase is present in uterine cervical carcinoma and it detaches viable and growing cervical squamous carcinoma cells from substratum in vitro.
21150220 2011 Impact of polymorphisms of the genes encoding angiotensin II-forming enzymes on the progression of IgA nephropathy.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20736038 2010 Association of STR polymorphisms in CMA1 and IL-4 with asthma and atopy: the SAPALDIA cohort.
20670150 2010 Elevated plasma chymotrypsin-like protease (chymase) activity in women with preeclampsia.
20659024 2010 [Analysis of morpho-functional parameters of the heart and polymorphisms of Renin-Angiotensin-aldosterone system genes in patients with different variants of the course of hypertrophic cardiomyopathy].
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20551380 2010 Proteomics characterization of extracellular space components in the human aorta.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
20423454 2010 Arg143 and Lys192 of the human mast cell chymase mediate the preference for acidic amino acids in position P2' of substrates.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19899640 [Complex analysis of genetic predisposition to ischemic stroke in Russians].
19853701 2009 Histologic characterization of hypertrophic cardiomyopathy with and without myofilament mutations.
19697770 2009 [Expression of tryptase and chymase in human lung tissue of anaphylactic shock].
19520069 2009 Analysis of polymorphism in renin angiotensin system and other related genes in South Indian chronic kidney disease patients.
19494363 2009 Chymotrypsin-like protease (chymase) mediates endothelial activation by factors derived from preeclamptic placentas.
19380825 2009 Alpha 2-macroglobulin capture allows detection of mast cell chymase in serum and creates a reservoir of angiotensin II-generating activity.
19332265 2009 Polymorphism in the angiotensin II type 1 receptor (AGTR1) is associated with age at diagnosis in pulmonary arterial hypertension.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19126871 2009 Placenta-derived chymotrypsin-like protease (CLP) disturbs endothelial junctional structure in preeclampsia.
19054851 2008 Human protein factory for converting the transcriptome into an in vitro-expressed proteome,.
18973102 2008 Association of polymorphisms in the mast cell chymase gene promoter region (-1903 g/A) and (TG)n(GA)m repeat downstream of the gene with bronchial asthma in children.
18958543 2008 Polymorphisms of matrix metalloproteinase-7 and chymase are associated with susceptibility to and progression of gastric cancer in Japan.
18856058 [Comparative genetic analysis of different forms of low-renin arterial hypertension].
18845543 2008 Mechanical induction of an epithelial cell chymase associated with wound edge migration.
18641516 2008 Genotype-phenotype associations between chymase and angiotensin-converting enzyme gene polymorphisms in chronic systolic heart failure patients.
18079408 2008 Activated mast cells induce endothelial cell apoptosis by a combined action of chymase and tumor necrosis factor-alpha.
17851694 2007 RAAS gene polymorphisms influence progression of pediatric hypertrophic cardiomyopathy.
17460374 2007 The effects of chymase on matrix metalloproteinase-2 activation in neointimal hyperplasia after balloon injury in dogs.
17334631 2007 Enhanced mast cell chymase expression in human idiopathic interstitial pneumonia.
17199219 2000 Pathological involvement of chymase-dependent angiotensin II formation in the development of cardiovascular disease.
17035401 2006 Influences of chymase and angiotensin I-converting enzyme gene polymorphisms on gastric cancer risks in Japan.
16962475 2006 Increased expression of the renin-angiotensin system and mast cell density but not of angiotensin-converting enzyme II in late stages of human heart failure.
16786130 2006 Immunohistochemical study of chymase-positive mast cells in inflammatory bowel disease.
16520412 2006 Advanced glycation end products activate a chymase-dependent angiotensin II-generating pathway in diabetic complications.
16446531 2006 Chymase gene (CMA1) polymorphisms in Dutch and Japanese sarcoidosis patients.
16400609 2006 Single-nucleotide polymorphisms in NAGNAG acceptors are highly predictive for variations of alternative splicing.
16317101 2006 Mast cells and neutrophils proteolytically activate chemokine precursor CTAP-III and are subject to counterregulation by PF-4 through inhibition of chymase and cathepsin G.
16134991 2005 Association study of mast cell chymase polymorphisms with atopy.
16020275 2005 Mast cell chymase induces conjunctival epithelial cell apoptosis by a mechanism involving degradation of fibronectin.
15924217 2005 A novel (TG)n(GA)m repeat polymorphism 254 bp downstream of the mast cell chymase (CMA1) gene is associated with atopic asthma and total serum IgE levels.
15919053 2005 Eosinophil migration induced by mast cell chymase is mediated by extracellular signal-regulated kinase pathway.
15914614 2005 Genetic polymorphisms in the angiotensin II receptor gene and their association with open-angle glaucoma in a Japanese population.
15788353 A study of the relationships between angiotensin- converting enzyme gene, chymase gene polymorphisms, pharmacological treatment with ACE inhibitor and regression of left ventricular hypertrophy in essential hypertension patients treated with benazepril.
15638376 2004 Immunohistochemical evaluation of mast cells and mark activity tryptase and chymase in experimental fibrosarcoma.
15555355 2004 [Association between angiotensin converting enzyme gene, chymase gene and regression of left ventricular hypertrophy in patients treated with angiotensin converting enzyme inhibitors].
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15449728 2004 Design and synthesis of indole and tetrahydroisoquinoline hydantoin derivatives as human chymase inhibitors.
15248847 2004 Polymorphism of the mast cell chymase gene (CMA1) promoter region: lack of association with asthma but association with serum total immunoglobulin E levels in adult atopic dermatitis.
15227657 2004 Mast cell chymase is a possible mediator of neurogenic bladder fibrosis.
15106801 2004 Heterozygous disruption of CMA1 does not affect blood pressure.
14757520 2004 Immunocytochemical expression of monocarboxylate transporters in the human visual cortex at midgestation.
14701812 2004 Depletion of pre-beta-high density lipoprotein by human chymase impairs ATP-binding cassette transporter A1- but not scavenger receptor class B type I-mediated lipid efflux to high density lipoprotein.
14592513 2003 Structure-activity relationship of benzo[b]thiophene-2-sulfonamide derivatives as novel human chymase inhibitors.
12815038 2003 Albumin is a substrate of human chymase. Prediction by combinatorial peptide screening and development of a selective inhibitor based on the albumin cleavage site.
12614156 2003 Structure of human pro-chymase: a model for the activating transition of granule-associated proteases.
12531890 2003 Degradation of phospholipid transfer protein (PLTP) and PLTP-generated pre-beta-high density lipoprotein by mast cell chymase impairs high affinity efflux of cholesterol from macrophage foam cells.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12499576 2002 Effect of chymase inhibitor on vascular proliferation.
12484503 2002 Possible roles of angiotensin II-forming enzymes, angiotensin converting enzyme and chymase-like enzyme, in the human aneurysmal aorta.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12446192 2002 Analysis of several hundred genetic polymorphisms may improve assessment of the individual genetic burden for coronary artery disease.
12359984 2002 Transgenic study of the function of chymase in heart remodeling.
12165749 2002 Angiotensin I-converting enzyme and chymase gene polymorphisms - relationship to left ventricular mass in type 2 diabetes patients.
12097409 2002 Mast cell chymase modifies cell-matrix interactions and inhibits mitogen-induced proliferation of human airway smooth muscle cells.
12062105 2002 Recruitment of stem and progenitor cells from the bone marrow niche requires MMP-9 mediated release of kit-ligand.
12047032 2002 Association of a mast cell chymase gene variant with HDL cholesterol, but not with blood pressure in the Ohasama study.
11751973 2002 Mast cell alpha-chymase reduces IgE recognition of birch pollen profilin by cleaving antibody-binding epitopes.
11696688 2001 A chymase gene variant is associated with atherosclerosis in venous coronary artery bypass grafts.
11502696 2001 Functional evidence for a role of vascular chymase in the production of angiotensin II in isolated human arteries.
11303326 2000 [Polymorphism of the chymase gene and development of retinopathy in type 2 diabetic patients].
11208365 Angiotensin II type 1 receptor gene A1166C polymorphism is associated with the increased risk of pregnancy-induced hypertension.
11096141 2000 Angiotensinogen M235T and chymase gene CMA/B polymorphisms are not associated with nephropathy in type II diabetes.
10899625 2000 Angiotensin II generation by mast cell alpha- and beta-chymases.
10224464 Novel autocrine and paracrine loops of the stem cell factor/chymase network.
10208809 1999 The 2.2 A Crystal Structure of Human Chymase in Complex with Succinyl-Ala-Ala-Pro-Phe-chloromethylketone: Structural Explanation for its Dipeptidyl Carboxypeptidase Specificity.
9931257 1999 The 2.2 A crystal structure of human chymase in complex with succinyl-Ala-Ala-Pro-Phe-chloromethylketone: structural explanation for its dipeptidyl carboxypeptidase specificity.
9675146 1998 Novel 31-amino-acid-length endothelins cause constriction of vascular smooth muscle.
9400368 1997 Crystal structure of phenylmethanesulfonyl fluoride-treated human chymase at 1.9 A.
9257865 1997 Selective conversion of big endothelins to tracheal smooth muscle-constricting 31-amino acid-length endothelins by chymase from human mast cells.
9256427 1997 Chymase cleavage of stem cell factor yields a bioactive, soluble product.
8695029 1996 Chymase-dependent angiotensin II forming systems in humans.
8495723 1993 Purification and molecular cloning of chymase from human tonsils.
8468056 1993 The human mast cell chymase gene (CMA1): mapping to the cathepsin G/granzyme gene cluster and lineage-restricted expression.
8226889 1993 Reaction of human chymase with reactive site variants of alpha 1-antichymotrypsin. Modulation of inhibitor versus substrate properties.
8144971 1994 Determination of the primary structures of human skin chymase and cathepsin G from cutaneous mast cells of urticaria pigmentosa lesions.
8027075 1994 Activation of human interstitial procollagenase through direct cleavage of the Leu83-Thr84 bond by mast cell chymase.
7682566 1993 Cellular localization and regional distribution of an angiotensin II-forming chymase in the heart.
2266130 1990 Identification of a highly specific chymase as the major angiotensin II-forming enzyme in the human heart.
2071582 1991 Structure, chromosomal assignment, and deduced amino acid sequence of a human gene for mast cell chymase.
2049082 1991 Angiotensin II-forming heart chymase is a mast-cell-specific enzyme.
1919436 1991 Rapid and specific conversion of precursor interleukin 1 beta (IL-1 beta) to an active IL-1 species by human mast cell chymase.
1894611 1991 Cloning of the gene and cDNA for human heart chymase.