Property Summary

Ligand Count 351
NCBI Gene PubMed Count 112
PubMed Score 1121.10
PubTator Score 479.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Atopic dermatitis -1.300 5.2e-03
cutaneous lupus erythematosus -1.400 1.8e-02
ductal carcinoma in situ -1.300 6.5e-04
invasive ductal carcinoma -1.900 3.7e-04
osteosarcoma -3.271 9.3e-05
psoriasis -1.700 7.1e-03

PDB (18)

Gene RIF (89)

AA Sequence

MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGR      1 - 70
SITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPP     71 - 140
GRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCA    141 - 210
GVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN                                     211 - 247
//

Text Mined References (115)

PMID Year Title