Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.45
PubTator Score 0.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
Schizophrenia 1160
Disease Target Count P-value
psoriasis 6694 3.1e-27
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Prostate cancer 175 0.0 1.2
Disease Target Count Z-score Confidence
Cataract 8 multiple types 33 4.584 2.3

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.700 3.1e-27

 GO Process (1)

Gene RIF (1)

AA Sequence

MTHLQAGLSPETLEKARLELNENPDTLHQDIQEVRDMVITRPDIGFLRTDDAFILRFLRARKFHHFEAFR      1 - 70
LLAQYFEYRQQNLDMFKSFKATDPGIKQALKDGFPGGLANLDHYGRKILVLFAANWDQSRYTLVDILRAI     71 - 140
LLSLEAMIEDPELQVNGFVLIIDWSNFTFKQASKLTPSMLRLAIEGLQDSFPARFGGIHFVNQPWYIHAL    141 - 210
YTVIRPFLKEKTRKRIFLHGNNLNSLHQLIHPEILPSEFGGMLPPYDMGTWARTLLDHEYDDDSEYNVDS    211 - 280
YSMPVKEVEKELSPKSMKRSQSVVDPTVLKRMDKNEEENMQPLLSLD                           281 - 327
//

Text Mined References (6)

PMID Year Title