Property Summary

NCBI Gene PubMed Count 11
PubMed Score 17.37
PubTator Score 11.17

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -4.138 2.7e-13
glioblastoma -1.100 1.6e-03
medulloblastoma, large-cell -1.100 1.4e-02
adult high grade glioma -1.400 9.1e-04
ovarian cancer 1.200 5.2e-04

 GO Process (1)

Gene RIF (2)

PMID Text
17203229 CLUAP1 (clusterin-associated protein 1) is highly expressed in osteosarcoma, ovarian, colon, and lung cancers
15480429 inactivation of CLUAP1 may conceivably serve in the future as a novel therapeutic intervention for treatment of colon cancer

AA Sequence

MSFRDLRNFTEMMRALGYPRHISMENFRTPNFGLVSEVLLWLVKRYEPQTDIPPDVDTEQDRVFFIKAIA      1 - 70
QFMATKAHIKLNTKKLYQADGYAVKELLKITSVLYNAMKTKGMEGSEIVEEDVNKFKFDLGSKIADLKAA     71 - 140
RQLASEITSKGASLYDLLGMEVELREMRTEAIARPLEINETEKVMRIAIKEILTQVQKTKDLLNNVASDE    141 - 210
ANLEAKIEKRKLELERNRKRLETLQSVRPCFMDEYEKTEEELQKQYDTYLEKFQNLTYLEQQLEDHHRME    211 - 280
QERFEEAKNTLCLIQNKLKEEEKRLLKSGSNDDSDIDIQEDDESDSELEERRLPKPQTAMEMLMQGRPGK    281 - 350
RIVGTMQGGDSDDNEDSEESEIDMEDDDDEDDDLEDESISLSPTKPNRRVRKSEPLDESDNDF           351 - 413
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19253336 2009 Characterization of mouse IFT complex B.
17203229 2007 Identification of CLUAP1 as a human osteosarcoma tumor-associated antigen recognized by the humoral immune system.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15530380 2004 Human cilia proteome contains homolog of zebrafish polycystic kidney disease gene qilin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15480429 2004 Isolation and characterization of a novel gene CLUAP1 whose expression is frequently upregulated in colon cancer.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9734811 1998 Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.