Property Summary

NCBI Gene PubMed Count 443
PubMed Score 2016.39
PubTator Score 889.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count P-value
lung carcinoma 2755 2.5e-10
pituitary cancer 1915 1.7e-07
malignant mesothelioma 3135 2.3e-07
group 3 medulloblastoma 4002 5.3e-07
colon cancer 1428 5.9e-07
non-small cell lung cancer 2799 7.2e-07
lung adenocarcinoma 2627 3.6e-06
Duchenne muscular dystrophy 587 6.1e-06
limb girdle muscular dystrophy 2A 208 4.8e-05
nasopharyngeal carcinoma 1024 7.0e-05
juvenile dermatomyositis 1147 7.3e-05
psoriasis 6514 1.2e-04
ovarian cancer 8297 2.3e-04
pancreatic carcinoma 555 3.9e-04
pancreatic cancer 2322 3.9e-04
atypical teratoid / rhabdoid tumor 4971 4.2e-04
acute quadriplegic myopathy 1133 6.4e-04
medulloblastoma, large-cell 6086 7.2e-04
cystic fibrosis 1629 7.9e-04
ulcerative colitis 1765 1.4e-03
Breast cancer 3469 2.5e-03
hepatocellular carcinoma 536 2.6e-03
intraductal papillary-mucinous carcinoma (IPMC) 2902 2.9e-03
subependymal giant cell astrocytoma 2230 3.5e-03
intraductal papillary-mucinous neoplasm (IPMN) 3204 3.8e-03
lung cancer 4607 5.4e-03
gastric cancer 445 7.8e-03
breast carcinoma 1589 7.9e-03
pancreatic ductal adenocarcinoma liver metastasis 1911 1.1e-02
astrocytoma 1113 1.3e-02
autosomal dominant Emery-Dreifuss muscular dystrophy 492 1.5e-02
Atopic dermatitis 915 1.6e-02
glioblastoma 5635 1.6e-02
primary Sjogren syndrome 710 2.5e-02
Gaucher disease type 3 65 2.7e-02
chronic kidney disease 80 3.1e-02
invasive ductal carcinoma 2867 4.0e-02
ductal carcinoma in situ 1686 4.2e-02
intraductal papillary-mucinous adenoma (IPMA) 2872 4.4e-02
chronic rhinosinusitis 505 4.5e-02
Disease Target Count Z-score Confidence
Alzheimer's disease 640 5.518 2.8
Panic disorder 57 0.0 1.9

Expression

  Differential Expression (40)

Disease log2 FC p
acute quadriplegic myopathy 1.283 6.4e-04
astrocytoma 2.000 1.3e-02
Atopic dermatitis -1.100 1.6e-02
atypical teratoid / rhabdoid tumor -1.600 4.2e-04
autosomal dominant Emery-Dreifuss muscul... 1.279 1.5e-02
Breast cancer -1.400 2.5e-03
breast carcinoma -1.100 7.9e-03
chronic kidney disease 1.800 3.1e-02
chronic rhinosinusitis -1.098 4.5e-02
colon cancer -3.100 5.9e-07
cystic fibrosis 3.000 7.9e-04
Duchenne muscular dystrophy 1.368 6.1e-06
ductal carcinoma in situ -1.700 4.2e-02
gastric cancer 1.300 7.8e-03
Gaucher disease type 3 -2.100 2.7e-02
glioblastoma 1.200 1.6e-02
group 3 medulloblastoma -2.500 5.3e-07
hepatocellular carcinoma 1.300 2.6e-03
intraductal papillary-mucinous adenoma (... -1.100 4.4e-02
intraductal papillary-mucinous carcinoma... -3.600 2.9e-03
intraductal papillary-mucinous neoplasm ... -4.000 3.8e-03
invasive ductal carcinoma -1.500 4.0e-02
juvenile dermatomyositis 1.198 7.3e-05
limb girdle muscular dystrophy 2A 1.305 4.8e-05
lung adenocarcinoma -2.300 3.6e-06
lung cancer -1.300 5.4e-03
lung carcinoma -1.400 2.5e-10
malignant mesothelioma 1.600 2.3e-07
medulloblastoma, large-cell -3.700 7.2e-04
nasopharyngeal carcinoma -2.900 7.0e-05
non-small cell lung cancer -1.293 7.2e-07
ovarian cancer 2.800 2.3e-04
pancreatic cancer 2.200 3.9e-04
pancreatic carcinoma 2.200 3.9e-04
pancreatic ductal adenocarcinoma liver m... -2.351 1.1e-02
pituitary cancer 2.000 1.7e-07
primary Sjogren syndrome 1.400 2.5e-02
psoriasis -1.200 1.2e-04
subependymal giant cell astrocytoma 2.187 3.5e-03
ulcerative colitis 2.600 1.4e-03

 IMPC Phenotype (1)

Gene RIF (377)

AA Sequence

MMKTLLLFVGLLLTWESGQVLGDQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTL      1 - 70
LSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQL     71 - 140
EEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFS    141 - 210
LPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDD    211 - 280
DRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQW    281 - 350
KMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVP    351 - 420
VEVSRKNPKFMETVAEKALQEYRKKHREE                                             421 - 449
//

Text Mined References (450)

PMID Year Title