Property Summary

NCBI Gene PubMed Count 443
PubMed Score 2016.39
PubTator Score 889.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count P-value
lung carcinoma 2843 2.5e-10
pituitary cancer 1972 1.7e-07
malignant mesothelioma 3232 2.3e-07
group 3 medulloblastoma 4104 5.3e-07
colon cancer 1478 5.9e-07
non-small cell lung cancer 2890 7.2e-07
lung adenocarcinoma 2716 3.6e-06
Duchenne muscular dystrophy 601 6.1e-06
limb girdle muscular dystrophy 2A 213 4.8e-05
nasopharyngeal carcinoma 1058 7.0e-05
juvenile dermatomyositis 1187 7.3e-05
psoriasis 6694 1.2e-04
ovarian cancer 8520 2.3e-04
pancreatic carcinoma 562 3.9e-04
pancreatic cancer 2398 3.9e-04
atypical teratoid / rhabdoid tumor 5112 4.2e-04
acute quadriplegic myopathy 1158 6.4e-04
medulloblastoma, large-cell 6241 7.2e-04
cystic fibrosis 1696 7.9e-04
ulcerative colitis 1819 1.4e-03
Breast cancer 3578 2.5e-03
hepatocellular carcinoma 547 2.6e-03
intraductal papillary-mucinous carcinoma (IPMC) 2989 2.9e-03
subependymal giant cell astrocytoma 2287 3.5e-03
intraductal papillary-mucinous neoplasm (IPMN) 3291 3.8e-03
lung cancer 4740 5.4e-03
gastric cancer 459 7.8e-03
breast carcinoma 1638 7.9e-03
pancreatic ductal adenocarcinoma liver metastasis 1962 1.1e-02
astrocytoma 1146 1.3e-02
autosomal dominant Emery-Dreifuss muscular dystrophy 510 1.5e-02
Atopic dermatitis 952 1.6e-02
glioblastoma 5792 1.6e-02
primary Sjogren syndrome 735 2.5e-02
Gaucher disease type 3 67 2.7e-02
chronic kidney disease 90 3.1e-02
invasive ductal carcinoma 2951 4.0e-02
ductal carcinoma in situ 1745 4.2e-02
intraductal papillary-mucinous adenoma (IPMA) 2955 4.4e-02
chronic rhinosinusitis 512 4.5e-02
Disease Target Count Z-score Confidence
Alzheimer's disease 658 5.518 2.8
Panic disorder 61 0.0 1.9

Expression

  Differential Expression (40)

Disease log2 FC p
acute quadriplegic myopathy 1.283 6.4e-04
astrocytoma 2.000 1.3e-02
Atopic dermatitis -1.100 1.6e-02
atypical teratoid / rhabdoid tumor -1.600 4.2e-04
autosomal dominant Emery-Dreifuss muscul... 1.279 1.5e-02
Breast cancer -1.400 2.5e-03
breast carcinoma -1.100 7.9e-03
chronic kidney disease 1.800 3.1e-02
chronic rhinosinusitis -1.098 4.5e-02
colon cancer -3.100 5.9e-07
cystic fibrosis 3.000 7.9e-04
Duchenne muscular dystrophy 1.368 6.1e-06
ductal carcinoma in situ -1.700 4.2e-02
gastric cancer 1.300 7.8e-03
Gaucher disease type 3 -2.100 2.7e-02
glioblastoma 1.200 1.6e-02
group 3 medulloblastoma -2.500 5.3e-07
hepatocellular carcinoma 1.300 2.6e-03
intraductal papillary-mucinous adenoma (... -1.100 4.4e-02
intraductal papillary-mucinous carcinoma... -3.600 2.9e-03
intraductal papillary-mucinous neoplasm ... -4.000 3.8e-03
invasive ductal carcinoma -1.500 4.0e-02
juvenile dermatomyositis 1.198 7.3e-05
limb girdle muscular dystrophy 2A 1.305 4.8e-05
lung adenocarcinoma -2.300 3.6e-06
lung cancer -1.300 5.4e-03
lung carcinoma -1.400 2.5e-10
malignant mesothelioma 1.600 2.3e-07
medulloblastoma, large-cell -3.700 7.2e-04
nasopharyngeal carcinoma -2.900 7.0e-05
non-small cell lung cancer -1.293 7.2e-07
ovarian cancer 2.800 2.3e-04
pancreatic cancer 2.200 3.9e-04
pancreatic carcinoma 2.200 3.9e-04
pancreatic ductal adenocarcinoma liver m... -2.351 1.1e-02
pituitary cancer 2.000 1.7e-07
primary Sjogren syndrome 1.400 2.5e-02
psoriasis -1.200 1.2e-04
subependymal giant cell astrocytoma 2.187 3.5e-03
ulcerative colitis 2.600 1.4e-03

 IMPC Phenotype (1)

Gene RIF (377)

AA Sequence

MMKTLLLFVGLLLTWESGQVLGDQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTL      1 - 70
LSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQL     71 - 140
EEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFS    141 - 210
LPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDD    211 - 280
DRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQW    281 - 350
KMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVP    351 - 420
VEVSRKNPKFMETVAEKALQEYRKKHREE                                             421 - 449
//

Text Mined References (450)

PMID Year Title