Property Summary

NCBI Gene PubMed Count 24
PubMed Score 62.15
PubTator Score 7.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma -2.000 3.4e-04
astrocytoma -1.500 3.6e-11
Astrocytoma, Pilocytic -1.300 7.8e-03
Atopic dermatitis -1.100 3.4e-03
atypical teratoid / rhabdoid tumor -1.800 2.4e-02
autosomal dominant Emery-Dreifuss muscul... 1.383 1.4e-03
Breast cancer -1.700 2.8e-05
Duchenne muscular dystrophy 1.002 8.4e-08
ductal carcinoma in situ -1.500 1.4e-02
ependymoma -1.100 4.9e-02
glioblastoma -1.500 4.7e-03
group 4 medulloblastoma 1.400 1.5e-03
intraductal papillary-mucinous adenoma (... -1.700 3.9e-03
intraductal papillary-mucinous carcinoma... -1.700 5.4e-03
intraductal papillary-mucinous neoplasm ... -2.100 1.1e-02
lung adenocarcinoma -2.000 3.0e-12
medulloblastoma, large-cell -2.500 3.1e-03
oligodendroglioma -1.600 6.7e-09
ovarian cancer -1.200 7.4e-04
primitive neuroectodermal tumor -2.200 1.7e-02
psoriasis -1.400 4.6e-08

 GO Function (1)

Gene RIF (13)

AA Sequence

MLPGRLCWVPLLLALGVGSGSGGGGDSRQRRLLAAKVNKHKPWIETSYHGVITENNDTVILDPPLVALDK      1 - 70
DAPVPFAGEICAFKIHGQELPFEAVVLNKTSGEGRLRAKSPIDCELQKEYTFIIQAYDCGAGPHETAWKK     71 - 140
SHKAVVHIQVKDVNEFAPTFKEPAYKAVVTEGKIYDSILQVEAIDEDCSPQYSQICNYEIVTTDVPFAID    141 - 210
RNGNIRNTEKLSYDKQHQYEILVTAYDCGQKPAAQDTLVQVDVKPVCKPGWQDWTKRIEYQPGSGSMPLF    211 - 280
PSIHLETCDGAVSSLQIVTELQTNYIGKGCDRETYSEKSLQKLCGASSGIIDLLPSPSAATNWTAGLLVD    281 - 350
SSEMIFKFDGRQGAKVPDGIVPKNLTDQFTITMWMKHGPSPGVRAEKETILCNSDKTEMNRHHYALYVHN    351 - 420
CRLVFLLRKDFDQADTFRPAEFHWKLDQICDKEWHYYVINVEFPVVTLYMDGATYEPYLVTNDWPIHPSH    421 - 490
IAMQLTVGACWQGGEVTKPQFAQFFHGSLASLTIRPGKMESQKVISCLQACKEGLDINSLESLGQGIKYH    491 - 560
FNPSQSILVMEGDDIGNINRALQKVSYINSRQFPTAGVRRLKVSSKVQCFGEDVCISIPEVDAYVMVLQA    561 - 630
IEPRITLRGTDHFWRPAAQFESARGVTLFPDIKIVSTFAKTEAPGDVKTTDPKSEVLEEMLHNLDFCDIL    631 - 700
VIGGDLDPRQECLELNHSELHQRHLDATNSTAGYSIYGVGSMSRYEQVLHHIRYRNWRPASLEARRFRIK    701 - 770
CSELNGRYTSNEFNLEVSILHEDQVSDKEHVNHLIVQPPFLQSVHHPESRSSIQHSSVVPSIATVVIIIS    771 - 840
VCMLVFVVAMGVYRVRIAHQHFIQETEAAKESEMDWDDSALTITVNPMEKHEGPGHGEDETEGEEEEEAE    841 - 910
EEMSSSSGSDDSEEEEEEEGMGRGRHGQNGARQAQLEWDDSTLPY                             911 - 955
//

Text Mined References (26)

PMID Year Title