Property Summary

NCBI Gene PubMed Count 16
PubMed Score 196.10
PubTator Score 37.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
hepatocellular carcinoma 1.100 1.4e-04
pancreatic cancer 1.200 1.5e-02
Multiple myeloma 1.229 1.2e-02
osteosarcoma -1.785 1.4e-05
pancreatic ductal adenocarcinoma liver m... -1.495 5.4e-04
tuberculosis and treatment for 6 months -1.500 8.5e-06
lung cancer 1.400 9.3e-04
Breast cancer 3.100 2.4e-02
atypical teratoid/rhabdoid tumor 1.200 3.8e-05
pancreatic carcinoma 1.200 1.5e-02
lung adenocarcinoma -1.200 3.2e-10
ovarian cancer 1.900 1.0e-03

Gene RIF (7)

PMID Text
26142927 results illustrate that ClpX overexpression is a good and simple model to study the underlying mechanisms of the UPRmt in mammalian cells.
25083874 Optical trapping to assay single-molecule ClpXP unfolding and translocation of substrates consisting of domains with varying stabilities and sequences; find that ClpXP unfolds most domains by a single pathway, with kinetics that depend on the native fold and structural stability.
22841477 human ClpX, a novel mtDNA regulator, maintains mtDNA nucleoid distribution through TFAM function as a chaperone rather than as a protease and its involvement in mtDNA segregation.
22710082 Walker B mutation in human CLPX exhibits improved interaction with the model unfolded substrate casein and several putative physiological substrates in vitro.
20877624 Observational study of gene-disease association. (HuGE Navigator)
18313382 Results reveal that the ssrA tag interacts with different loops that form the top, middle, and lower portions of the central channel of the ClpX hexamer.
16115876 hClpX can regulate the appearance of hClpP peptidase activity in mitochondria and might affect the nature of the degradation products released during ATP-dependent proteolytic cycles

AA Sequence

MPSCGACTCGAAAVRLITSSLASAQRGISGGRIHMSVLGRLGTFETQILQRAPLRSFTETPAYFASKDGI      1 - 70
SKDGSGDGNKKSASEGSSKKSGSGNSGKGGNQLRCPKCGDLCTHVETFVSSTRFVKCEKCHHFFVVLSEA     71 - 140
DSKKSIIKEPESAAEAVKLAFQQKPPPPPKKIYNYLDKYVVGQSFAKKVLSVAVYNHYKRIYNNIPANLR    141 - 210
QQAEVEKQTSLTPRELEIRRREDEYRFTKLLQIAGISPHGNALGASMQQQVNQQIPQEKRGGEVLDSSHD    211 - 280
DIKLEKSNILLLGPTGSGKTLLAQTLAKCLDVPFAICDCTTLTQAGYVGEDIESVIAKLLQDANYNVEKA    281 - 350
QQGIVFLDEVDKIGSVPGIHQLRDVGGEGVQQGLLKLLEGTIVNVPEKNSRKLRGETVQVDTTNILFVAS    351 - 420
GAFNGLDRIISRRKNEKYLGFGTPSNLGKGRRAAAAADLANRSGESNTHQDIEEKDRLLRHVEARDLIEF    421 - 490
GMIPEFVGRLPVVVPLHSLDEKTLVQILTEPRNAVIPQYQALFSMDKCELNVTEDALKAIARLALERKTG    491 - 560
ARGLRSIMEKLLLEPMFEVPNSDIVCVEVDKEVVEGKKEPGYIRAPTKESSEEEYDSGVEEEGWPRQADA    561 - 630
ANS                                                                       631 - 633
//

Text Mined References (27)

PMID Year Title
26142927 2015 ClpX stimulates the mitochondrial unfolded protein response (UPRmt) in mammalian cells.
25957689 2015 Mitochondrial ClpX Activates a Key Enzyme for Heme Biosynthesis and Erythropoiesis.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25083874 2014 Stochastic but highly coordinated protein unfolding and translocation by the ClpXP proteolytic machine.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22841477 2012 Maintenance of mitochondrial genome distribution by mitochondrial AAA+ protein ClpX.
22710082 2012 Substrate recognition and processing by a Walker B mutant of the human mitochondrial AAA+ protein CLPX.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18313382 2008 Diverse pore loops of the AAA+ ClpX machine mediate unassisted and adaptor-dependent recognition of ssrA-tagged substrates.
18063578 2008 The layered structure of human mitochondrial DNA nucleoids.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16115876 2005 Human mitochondrial ClpP is a stable heptamer that assembles into a tetradecamer in the presence of ClpX.
15522782 2004 Crystallography and mutagenesis point to an essential role for the N-terminus of human mitochondrial ClpP.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11923310 2002 Functional proteolytic complexes of the human mitochondrial ATP-dependent protease, hClpXP.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11003706 2000 Human and mouse mitochondrial orthologs of bacterial ClpX.
10525407 1999 Mitochondrial localization and oligomeric structure of HClpP, the human homologue of E. coli ClpP.
10347188 1999 Molecular cloning and characterization of a mouse homolog of bacterial ClpX, a novel mammalian class II member of the Hsp100/Clp chaperone family.