Property Summary

NCBI Gene PubMed Count 78
PubMed Score 51.79
PubTator Score 70.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
group 3 medulloblastoma 1.500 8.9e-04
juvenile dermatomyositis 1.153 2.5e-11
acute quadriplegic myopathy 1.163 3.2e-07
pancreatic ductal adenocarcinoma liver m... -1.858 1.4e-02
diabetes mellitus -1.100 3.7e-03
non primary Sjogren syndrome sicca 1.200 3.6e-02
ovarian cancer 3.200 1.1e-06

Gene RIF (62)

PMID Text
26621837 Data suggest that single nucleotide polymorphisms (SNPs) in the telomerase (TERT)-cleft lip and palate transmembrane protein 1-like protein (CLPTM1L) locus may play a role in mediating the susceptibility to nasopharyngeal carcinoma (NPC) in Chinese.
26545403 CLPTM1L Polymorphism is associated with Nasopharyngeal Carcinoma.
25966219 rs2736100 on TERT-CLPTM1L indicates a poor prognosis for lung cancer in the Chinese Han population.
25526467 consumption of alcohol may interact with CLPTM1L polymorphisms to contribute to overall lung cancer susceptibility.
25487306 Using TCGA RNASeq data, we found significantly increased expression of both TERT and CLPTM1L in endometrial cancer tissue compared with normal tissue (TERT P = 1.5 x 10(-18), CLPTM1L P = 1.5 x 10(-19)).
25480402 miR-494 regulates cell growth, invasion and apoptosis of esophageal squamous cell carcinoma cells by targeting CLPTM1L.
25422207 This study showed that genetic variation rs31489 in 5p15.33 was directly associated with the reduced risk of lung cancer in Han Chinese. The CLPTM1L gene rs31489-A allele was a protective factor for the development of lung cancer only in nonsmokers.
25339005 Polymorphisms of CLPTM1L gene is associated with the risk of hepatocellular carcinoma.
25284078 This meta-analysis suggests that T allele of CLPTM1L-telomerase reverse transcriptase rs401681 polymorphism is associated with an increased PC risk, especially among Chinese.
25155038 CLPTM1L polymorphisms did not affect the tumor sensitivity to cisplatin combination chemotherapy in our study patients.
25122662 Whole exome sequencing followed by immunohistochemistry of fibrolamellar hepatocellular carcinoma cell lines and tumors showed two structural variants resulting in fusion transcripts: DNAJB1-PRKCA and CLPTM1L-GLIS3.
25037574 association of the CLPTM1L polymorphism and the risk of the lung cancer in non-smoking females in China
25027329 Six independent risk neoplasm loci marked by common single-nucleotide polymorphisms have been found: five in the TERT gene, and one in CLPTM1L gene, both on chromosome 5.
25007268 TERT-CLPTM1L rs401681 CT and CT/TT genotypes are associated with decreased risk of esophageal squamous cell carcinoma.
24957041 Our meta-analysis provides supportive evidence that CRR9p polymorphism may influence a risk of lung cancer and non-small cell lung cancer in a protective model.
24907075 CLPTM1L polymorphisms rs402710 and rs401681 are risk-conferring factors for the development of lung cancer. [Meta-analysis]
24861918 CLPTM1L-rs401681 polymorphism was not associated with lung cancer risk in Chinese males.
24648346 Results suggest that CLPTM1L functions as a growth-promoting gene in the pancreas and that overexpression may lead to an abrogation of normal cytokinesis.
24634236 our study indicated that the CLPTM1L - rs401681 (G>A) polymorphism was significantly associated with decreased lung cancer risk, especially among European populations.
24615621 CLPTM1L SNPs are associated with nasopharyngeal carcinoma risk.
24577890 the T allele of rs401681 in CLPTM1L-TERT locus predisposes its carriers to pancreatic cancer.
24535780 CLPTM1L rs31489 was a potential biomarker for lung cancer risk in Caucasians
24386361 the role of TERT-CLPTM1L variants in the etiology of esophageal squamous cell carcinoma and lung cancer
24366883 A protumorigenic role for CLPTM1L that is critical for Ras-driven lung cancers, with potential implications for therapy and chemosensitization.
24175795 CLPTM1L SNPs (rs401681 and rs4975616) were not associated with non-small cell lung cancer in a non-smoking Han Chinese population.
23908149 Polymorphism in CLPTM1L gene is associated with lung cancer.
23738012 Genetic variants in TERT and CLPTM1L may affect the susceptibility of lung cancer
23707794 TERT-CLPTM1L genomic region was associated with increased risk of cancer.
23653681 The 5p15.33 locus involving CLPTM1L polymorphisms is significantly associated with lung cancer risk.
23555636 Longer telomere length in peripheral white blood cells is associated with risk of lung cancer and the rs2736100 (CLPTM1L-TERT) polymorphism.
23433592 Our results reiterate that genetic variants of TERT and CLPTM1L contribute to lung cancer susceptibility in Chinese population.
23368278 The 5p15.33 region containing telomerase reverse transcriptase gene (TERT) and cleft lip and palate transmembrane protein 1-like (CLPTM1L) gene showed significant association with lung cancer in Han Chinese.
23359026 results suggest that genetic variants in the TERT-CLPTM1L gene may predispose individuals to be susceptible to lung cancer, particularly non-small cell lung cancer, in the Chinese population
23300716 CLPTM1L is a mitochondria protein that may be associated with an anti-apoptotic mechanism which affects drug-resistance in lung cancer cells.
23226346 association between genetic polymorphism and cancer risk
23137523 Further molecular characterization by flow-FISH and quantitative RT-PCR suggest TERT and CLPTM1L as target genes of 5p15.33 rearrangements.
22893025 TERT-CLPTM1L rs401681[C] allele is risk factor for basal cell carcinoma but not for squamous cell carcinoma.
22675468 This study implicates anti-apoptotic CLPTM1L function as a potential mechanism of susceptibility to lung tumorigenesis and resistance to chemotherapy.
22370939 The CT genotype at rs401681 was more common and the TT genotype was rare in patients, and the differences were significant between lung adenocarcinoma patients and controls. This was also true for rs402710. Moreover, the frequency of the GGCTCT haplotype was higher and the TTTTTT frequency was lower in patients, especially those with lung adenocarcinoma.
22213090 haplotype G-T-A in CLPTM1L also confers a risk to glioma suggesting CLPTM1L is also involved in the etiology of glioma.
22134622 We genotyped eleven SNPs in 2,892 women of African descent but were unable to detect any significant association between TERT-CLPTM1L SNPs and their predispositions for breast cancer risk.
22037553 We identified a common risk variant for estrogen receptor-negative breast cancer at the TERT-CLPTM1L locus on chromosome 5p15: rs10069690
21993562 the TERT-CLPTM1L locus influences melanoma risk.
21771723 Single-nucleotide polymorphisms in CLPTM1L is associated with lung cancer.
21622582 the lung cancer susceptibility locus Tert-Clptm1l on chromosome 5p15.33 increases the risk for bronchial obstruction and emphysema.
21617256 variants in or near BAK1, DMRT1, TERT-CLPTM1L, and KITLG predispose to familial and bilateral TGCT.
21332924 The absence of association of a single-nucleotide polymorphism in the TERT-CLPTM1L locus with age-related phenotypes was found in a large multicohort study.
21081471 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20802237 Single nucleotide polymorphisms in CLPTM1L is associated with squamous cell carcinoma of the head and neck.
20802237 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20700438 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20570912 The observed associations between rs401681 and several cancers might be weaker than previously described. Lack of an association between the SNP and mean telomere length suggests association with cancer risk at this locus is not mediated through TERT.
20548021 Meta-analysis of gene-disease association. (HuGE Navigator)
20543847 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20101243 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
19955392 Observational study of gene-disease association. (HuGE Navigator)
19578363 Observational study of gene-disease association. (HuGE Navigator)
19369581 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19151717 Sequence variants at the TERT-CLPTM1L locus associate with many cancer types.
18978790 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18978790 The susceptibility region contains two genes, TERT and CLPTM1L, suggesting that one or both may have a role in lung cancer etiology.
18978787 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MWSGRSSFTSLVVGVFVVYVVHTCWVMYGIVYTRPCSGDANCIQPYLARRPKLQLSVYTTTRSHLGAENN      1 - 70
IDLVLNVEDFDVESKFERTVNVSVPKKTRNNGTLYAYIFLHHAGVLPWHDGKQVHLVSPLTTYMVPKPEE     71 - 140
INLLTGESDTQQIEAEKKPTSALDEPVSHWRPRLALNVMADNFVFDGSSLPADVHRYMKMIQLGKTVHYL    141 - 210
PILFIDQLSNRVKDLMVINRSTTELPLTVSYDKVSLGRLRFWIHMQDAVYSLQQFGFSEKDADEVKGIFV    211 - 280
DTNLYFLALTFFVAAFHLLFDFLAFKNDISFWKKKKSMIGMSTKAVLWRCFSTVVIFLFLLDEQTSLLVL    281 - 350
VPAGVGAAIELWKVKKALKMTIFWRGLMPEFQFGTYSESERKTEEYDTQAMKYLSYLLYPLCVGGAVYSL    351 - 420
LNIKYKSWYSWLINSFVNGVYAFGFLFMLPQLFVNYKLKSVAHLPWKAFTYKAFNTFIDDVFAFIITMPT    421 - 490
SHRLACFRDDVVFLVYLYQRWLYPVDKRRVNEFGESYEEKATRAPHTD                          491 - 538
//

Text Mined References (84)

PMID Year Title
26621837 2016 Common variations in TERT-CLPTM1L locus are reproducibly associated with the risk of nasopharyngeal carcinoma in Chinese populations.
26545403 2016 A GWAS Meta-analysis and Replication Study Identifies a Novel Locus within CLPTM1L/TERT Associated with Nasopharyngeal Carcinoma in Individuals of Chinese Ancestry.
26372813 2015 Genetic variations in the TERT and CLPTM1L gene region and gastrointestinal stromal tumors risk.
26064290 2015 CLPTM1L polymorphism and lung cancer risk.
25966219 2015 Association of genetic polymorphisms in TERT-CLPTM1L with lung cancer in a Chinese population.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25940397 2015 TERT gene harbors multiple variants associated with pancreatic cancer susceptibility.
25837821 2015 Inherited genetic variants associated with occurrence of multiple primary melanoma.
25526467 2014 CLPTM1L genetic polymorphisms and interaction with smoking and alcohol drinking in lung cancer risk: a case-control study in the Han population from northwest China.
25487306 2015 Candidate locus analysis of the TERT-CLPTM1L cancer risk region on chromosome 5p15 identifies multiple independent variants associated with endometrial cancer risk.
25480402 2015 Upregulation of miR-494 Inhibits Cell Growth and Invasion and Induces Cell Apoptosis by Targeting Cleft Lip and Palate Transmembrane 1-Like in Esophageal Squamous Cell Carcinoma.
25422207 2014 Genetic variant in CLPTM1L confers reduced risk of lung cancer: a replication study in Chinese and a meta-analysis.
25339005 2014 Polymorphisms of TERT and CLPTM1L and the risk of hepatocellular carcinoma in Chinese males.
25284078 2015 Association between CLPTM1L-TERT rs401681 polymorphism and risk of pancreatic cancer: a meta-analysis.
25155038 2014 Correlation of CLPTM1L polymorphisms with lung cancer susceptibility and response to cisplatin-based chemotherapy in a Chinese Han population.
25122662 2015 Genomic analysis of fibrolamellar hepatocellular carcinoma.
25086665 2014 Genome-wide association study identifies multiple susceptibility loci for pancreatic cancer.
25037574 2014 Genetic polymorphisms of TERT and CLPTM1L, cooking oil fume exposure, and risk of lung cancer: a case-control study in a Chinese non-smoking female population.
25027329 2014 Imputation and subset-based association analysis across different cancer types identifies multiple independent risk loci in the TERT-CLPTM1L region on chromosome 5p15.33.
25007268 2014 TERT-CLPTM1L Rs401681 C>T polymorphism was associated with a decreased risk of esophageal cancer in a Chinese population.
24957041 2014 CRR9p polymorphism as a protective factor for lung cancer.
24907075 2014 Association between CLPTM1L polymorphisms (rs402710 and rs401681) and lung cancer susceptibility: evidence from 27 case-control studies.
24861918 2014 Genetic polymorphisms of TERT and CLPTM1L and risk of lung cancer: a case-control study in northeast Chinese male population.
24648346 2014 CLPTM1L promotes growth and enhances aneuploidy in pancreatic cancer cells.
24634236 2014 Decreased risk of developing lung cancer in subjects carrying the CLPTM1L rs401681 (G>A) polymorphism: evidence from a meta-analysis.
24615621 2014 Multigene pathway-based analyses identify nasopharyngeal carcinoma risk associations for cumulative adverse effects of TERT-CLPTM1L and DNA double-strand breaks repair.
24577890 2014 Association between CLPTM1L-TERT rs401681 polymorphism and pancreatic cancer risk among Chinese Han population.
24535780 2014 Cleft lip and palate transmembrane protein 1 rs31489 polymorphism is associated with lung cancer risk: a meta-analysis.
24403052 2014 Germline sequence variants in TGM3 and RGS22 confer risk of basal cell carcinoma.
24386361 2013 Genetic variant rs401681 at 5p15.33 modifies susceptibility to lung cancer but not esophageal squamous cell carcinoma.
24366883 2014 CRR9/CLPTM1L regulates cell survival signaling and is required for Ras transformation and lung tumorigenesis.
24292274 2014 A genome-wide association study identifies multiple susceptibility loci for chronic lymphocytic leukemia.
24175795 2013 No association of XRCC1 and CLPTM1L polymorphisms with non-small cell lung cancer in a non-smoking Han Chinese population.
24163127 2014 Genome-wide association study identifies multiple loci associated with bladder cancer risk.
23908149 2013 Genetic variations in TERT-CLPTM1L locus are associated with risk of lung cancer in Chinese population.
23738012 2013 Genetic variations in TERT-CLPTM1L genes and risk of lung cancer in Chinese women nonsmokers.
23707794 2013 Genetic variants in TERT-CLPTM1L genetic region associated with several types of cancer: a meta-analysis.
23666240 2013 Identification of nine new susceptibility loci for testicular cancer, including variants near DAZL and PRDM14.
23653681 2013 Replication study in Chinese population and meta-analysis supports association of the 5p15.33 locus with lung cancer.
23555636 2013 Longer telomere length in peripheral white blood cells is associated with risk of lung cancer and the rs2736100 (CLPTM1L-TERT) polymorphism in a prospective cohort study among women in China.
23433592 2013 Genetic polymorphisms of TERT and CLPTM1L and risk of lung cancer--a case-control study in a Chinese population.
23368278 2013 Significant association of 5p15.33 (TERT-CLPTM1L genes) with lung cancer in Chinese Han population.
23359026 2013 The genetic variant rs401681C/T is associated with the risk of non-small cell lung cancer in a Chinese mainland population.
23300716 2012 CLPTM1L is overexpressed in lung cancer and associated with apoptosis.
23226346 2012 TERT-CLPTM1L polymorphism rs401681 contributes to cancers risk: evidence from a meta-analysis based on 29 publications.
23137523 2013 Molecular characterization of chromosomal band 5p15.33: a recurrent breakpoint region in mantle cell lymphoma involving the TERT-CLPTM1L locus.
22893025 2013 Association between TERT-CLPTM1L rs401681[C] allele and NMSC cancer risk: a meta-analysis including 45,184 subjects.
22675468 2012 Functional characterization of CLPTM1L as a lung cancer risk candidate gene in the 5p15.33 locus.
22370939 2012 Multiple variants of TERT and CLPTM1L constitute risk factors for lung adenocarcinoma.
22213090 2012 Fine-mapping of a region of chromosome 5p15.33 (TERT-CLPTM1L) suggests a novel locus in TERT and a CLPTM1L haplotype are associated with glioma susceptibility in a Chinese population.
22134622 2012 Lack of association between common single nucleotide polymorphisms in the TERT-CLPTM1L locus and breast cancer in women of African ancestry.
22037553 2011 A common variant at the TERT-CLPTM1L locus is associated with estrogen receptor-negative breast cancer.
21993562 2012 Meta-analysis combining new and existing data sets confirms that the TERT-CLPTM1L locus influences melanoma risk.
21983787 2011 Genome-wide association study identifies three new melanoma susceptibility loci.
21771723 2011 Novel genetic variants in the chromosome 5p15.33 region associate with lung cancer risk.
21622582 2011 The TERT-CLPTM1L locus for lung cancer predisposes to bronchial obstruction and emphysema.
21617256 2011 Variants in or near KITLG, BAK1, DMRT1, and TERT-CLPTM1L predispose to familial testicular germ cell tumour.
21332924 2011 Absence of association of a single-nucleotide polymorphism in the TERT-CLPTM1L locus with age-related phenotypes in a large multicohort study: the HALCyon programme.
21269460 2011 Initial characterization of the human central proteome.
21160077 2010 Genetic correction of PSA values using sequence variants associated with PSA levels.
21081471 2011 Genetic variations on chromosomes 5p15 and 15q25 and bladder cancer risk: findings from the Los Angeles-Shanghai bladder case-control study.
20972438 2010 A multi-stage genome-wide association study of bladder cancer identifies multiple susceptibility loci.
20802237 2010 Genetic variations in TERT-CLPTM1L genes and risk of squamous cell carcinoma of the head and neck.
20700438 2010 The 5p15.33 locus is associated with risk of lung adenocarcinoma in never-smoking females in Asia.
20570912 2010 No association between TERT-CLPTM1L single nucleotide polymorphism rs401681 and mean telomere length or cancer risk.
20548021 2010 Replication of lung cancer susceptibility loci at chromosomes 15q25, 5p15, and 6p21: a pooled analysis from the International Lung Cancer Consortium.
20543847 2010 Variants near DMRT1, TERT and ATF7IP are associated with testicular germ cell cancer.
20101243 2010 A genome-wide association study identifies pancreatic cancer susceptibility loci on chromosomes 13q22.1, 1q32.1 and 5p15.33.
19955392 2010 Role of 5p15.33 (TERT-CLPTM1L), 6p21.33 and 15q25.1 (CHRNA5-CHRNA3) variation and lung cancer risk in never-smokers.
19946888 2010 Defining the membrane proteome of NK cells.
19836008 2009 A genome-wide association study of lung cancer identifies a region of chromosome 5p15 associated with risk for adenocarcinoma.
19654303 2009 Deciphering the impact of common genetic variation on lung cancer risk: a genome-wide association study.
19578363 2009 New common variants affecting susceptibility to basal cell carcinoma.
19369581 2009 Common genetic variants on 5p15.33 contribute to risk of lung adenocarcinoma in a Chinese population.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19151717 2009 Sequence variants at the TERT-CLPTM1L locus associate with many cancer types.
18978790 2008 Lung cancer susceptibility locus at 5p15.33.
18978787 2008 Common 5p15.33 and 6p21.33 variants influence lung cancer risk.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11162647 2001 A novel gene, CRR9, which was up-regulated in CDDP-resistant ovarian tumor cell line, was associated with apoptosis.